KEGG   Sinorhizobium meliloti SM11: SM11_chr3493Help
Entry
SM11_chr3493      CDS       T01885                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:smx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SM11_chr3493 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SM11_chr3493 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SM11_chr3493 (trpA)
Enzymes [BR:smx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SM11_chr3493 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3534517..3535356
Genome map
AA seq 279 aa AA seqDB search
MTARMEQRFADVAAEGRPVLVTYFMGGDPDFDTSLAIMKALRQAGADIIELGVPFSDPMA
DGPAIQLAGQRALKAGQSLAKTLELARLFRAEDQRTPIVLMGYYNPIYIYGVERFLADAL
EAGVDGLIVVDLPPEMDDELCIPALEKGISFIRLATPTTDDRRLPKVLENTSGFVYYVSM
TGITGSALPDPSLIAGAVARIKAHTPLPVCVGFGVKTADHARAIGASADGVVVGTAIVNQ
IASSLTEEGRATEATVPGVEALVRGLAAGVRAARLAAAE
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacgcatggagcaacggttcgccgacgtggcggccgaggggcgcccggtcctc
gtgacctatttcatgggcggcgacccggatttcgacacgtcgctggcgatcatgaaggcg
ctgcggcaggcgggtgccgacatcatcgaactcggcgtgcccttttccgacccgatggcc
gatggaccggcgatccagctcgccggccagcgcgcgctgaaggcggggcagtctctcgcc
aagacgctggagctcgcccggctcttccgggcggaggaccagcgcacccccatcgtgctg
atgggctattacaacccgatctatatctatggcgtcgagcggttcctggcggacgcactc
gaggccggcgtcgacggcctgatcgtcgtcgatctgcccccggaaatggacgacgaactc
tgcattccggcacttgagaagggcatcagcttcatccgcctggcaacgcccacgacggac
gatcgccgcctgcccaaggttctcgaaaacacgtcgggtttcgtgtattacgtctcgatg
accgggatcaccggctcggcgctgcccgatccgtcgctgatcgccggagcggtcgcgcgc
atcaaggcgcatacgcccttgcctgtctgcgtcggcttcggggtgaagaccgccgaccat
gcgcgcgccatcggcgcatccgcagacggcgtcgtcgtcggcacggcgatcgtcaatcag
atcgcgtcgagcttgaccgaagaaggccgggcaacggaagcgacggtcccgggtgtcgaa
gcgctcgtcagggggcttgcggccggcgtacgggcggcacggcttgctgcagccgaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system