KEGG   Sinorhizobium meliloti SM11: SM11_chr3493Help
Entry
SM11_chr3493      CDS       T01885                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:smx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SM11_chr3493 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SM11_chr3493 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SM11_chr3493 (trpA)
Enzymes [BR:smx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SM11_chr3493 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3534517..3535356
Genome map
AA seq 279 aa AA seqDB search
MTARMEQRFADVAAEGRPVLVTYFMGGDPDFDTSLAIMKALRQAGADIIELGVPFSDPMA
DGPAIQLAGQRALKAGQSLAKTLELARLFRAEDQRTPIVLMGYYNPIYIYGVERFLADAL
EAGVDGLIVVDLPPEMDDELCIPALEKGISFIRLATPTTDDRRLPKVLENTSGFVYYVSM
TGITGSALPDPSLIAGAVARIKAHTPLPVCVGFGVKTADHARAIGASADGVVVGTAIVNQ
IASSLTEEGRATEATVPGVEALVRGLAAGVRAARLAAAE
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacgcatggagcaacggttcgccgacgtggcggccgaggggcgcccggtcctc
gtgacctatttcatgggcggcgacccggatttcgacacgtcgctggcgatcatgaaggcg
ctgcggcaggcgggtgccgacatcatcgaactcggcgtgcccttttccgacccgatggcc
gatggaccggcgatccagctcgccggccagcgcgcgctgaaggcggggcagtctctcgcc
aagacgctggagctcgcccggctcttccgggcggaggaccagcgcacccccatcgtgctg
atgggctattacaacccgatctatatctatggcgtcgagcggttcctggcggacgcactc
gaggccggcgtcgacggcctgatcgtcgtcgatctgcccccggaaatggacgacgaactc
tgcattccggcacttgagaagggcatcagcttcatccgcctggcaacgcccacgacggac
gatcgccgcctgcccaaggttctcgaaaacacgtcgggtttcgtgtattacgtctcgatg
accgggatcaccggctcggcgctgcccgatccgtcgctgatcgccggagcggtcgcgcgc
atcaaggcgcatacgcccttgcctgtctgcgtcggcttcggggtgaagaccgccgaccat
gcgcgcgccatcggcgcatccgcagacggcgtcgtcgtcggcacggcgatcgtcaatcag
atcgcgtcgagcttgaccgaagaaggccgggcaacggaagcgacggtcccgggtgtcgaa
gcgctcgtcagggggcttgcggccggcgtacgggcggcacggcttgctgcagccgaataa

DBGET integrated database retrieval system