KEGG   Sinorhizobium meliloti SM11: SM11_chr3527Help
Entry
SM11_chr3527      CDS       T01885                                 

Gene name
glcB
Definition
(RefSeq) probabable malate synthase g protein
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:smx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SM11_chr3527 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SM11_chr3527 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    SM11_chr3527 (glcB)
Enzymes [BR:smx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SM11_chr3527 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3575335..3577506
Genome map
AA seq 723 aa AA seqDB search
MDRVEKYGLQIDAGLHRFLVEEAMPGTGVDADRFFSAFSDLVHDLGPKNRALLVKRDELQ
ARLDGWYREHGAPVDMEAYEAFLREIGYLLPEGPDFYVSTANVDSEIATIAGPQLVVPVM
NARYALNAANARWGSLYDALYGTDAIAETDGAERGKGYNPKRGAKVIAWAREFLDASAPL
AAGRWSDAKSFSVEGATLTVTLADGTKSAPRNSVQFAGYAGDPAAPSEIVLRRNGLHIVI
VLDATTPIGKADAAGISDVVLESAITTIMDCEDSVAAVDAEDKVLVYRNWLGLMKGDLEE
EVTKGGRAFTRRLNPDRAYTAPDGATLTLPGRSLMLVRNVGHLMTNPAVLDRDGEEVPEG
LMDAMVTALIALHDIGRNGRRANSRSGSMYVVKPKMHGPEEVAFACEIFARVEAALGLPA
NAMKMGIMDEERRTTVNLKECIRAARERVVFINTGFLDRTGDEIHTSMEAGPMIRKGDMK
QAPWISAYENWNVDVGLECGLSGHAQIGKGMWAMPDLMAAMLEQKIVHPKAGANTAWVPS
PTAATLHATHYHRVNVAEVQASLKSRTRAKLADILSVPVAARPNWTEEEIQRELDNNAQG
ILGYVVRWVDQGVGCSKVPDINNVGLMEDRATLRISAQHMANWLHHGIVSEAQIVETMQR
MAAIVDGQNAGDPNYQPMAGRFEESIAFQAALDLVLKGREQPNGYTEPVLHRRRLELKAK
QGA
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggaccgcgttgagaaatatggattgcagatcgatgcggggctccaccgctttctggtc
gaagaggcgatgccgggcaccggcgtcgacgcggatcggttcttttccgccttctctgat
ctcgttcacgatctcggaccgaagaaccgggcccttctcgtcaagcgcgacgagctgcag
gccaggctcgacggctggtatcgcgagcatggtgccccggtcgacatggaagcctatgaa
gccttcctgcgggagatcggctacctcctgcccgaaggtcccgatttttacgtctcgacc
gcaaatgtcgattccgagatcgcgacgatcgccgggccgcagcttgtcgtgccggtgatg
aacgcccgctatgcgctcaatgccgccaatgcccgctggggatcgctctacgacgccctt
tacggcaccgatgcgatagccgagaccgacggggccgagcgcggcaagggatacaatccg
aagcgcggtgccaaggtcatcgcctgggcgcgagaatttctcgacgcgagcgccccgctg
gcggccggccgctggagcgatgccaaatcgttctcggtcgagggagcgacgctaaccgta
acgcttgccgacggcacgaagagcgcgccgcgcaattccgttcagttcgccggctatgcc
ggtgaccccgcggcgccgtccgagatcgttctgcgtcggaacggccttcacatcgtcatc
gtcctcgacgcgacgacaccgatcggcaaggccgacgccgccggcatttccgacgtcgtt
ttggaatcggcgatcaccacgatcatggattgcgaggattcggtcgcggccgtcgatgcc
gaggacaaggtgctcgtctaccgcaactggctcgggctgatgaaaggcgatctcgaggag
gaggtgaccaagggcggcagggcgttcacccggaggctcaaccccgatagggcctatacg
gctccggacggtgcgacgctgacactgccggggcggtcgctgatgctggtgcgcaatgtc
ggccacctgatgaccaaccccgcggtcctcgaccgggacggcgaagaggtgccggaaggc
ctgatggacgccatggtgacggcgttgatcgcactccacgacatcggccggaacggtcgg
cgggcgaattcccgcagcggctccatgtatgtggtcaagccgaaaatgcatgggccggag
gaagtcgccttcgcctgcgagatattcgcccgcgtagaggcggcgctcgggcttccggcc
aacgcgatgaagatgggaatcatggacgaggagcggcggacgaccgtcaacctcaaggaa
tgcatccgcgccgcccgcgaacgggtcgtcttcatcaataccggcttcctcgaccgcacc
ggcgacgaaatccacacttcgatggaagccggaccgatgatccgcaagggcgacatgaag
caggcgccgtggatatcggcctatgagaactggaacgtcgatgtcggtcttgaatgcggg
ctttccggccacgcccagatcggcaagggcatgtgggcgatgccggacctgatggcggcg
atgctggagcagaagatcgtccatccgaaggcgggcgcgaacacggcctgggtaccgtcg
ccgacggccgcgactctgcacgcgacccactatcaccgcgtcaacgtcgccgaagtccag
gcgagcctcaagagccgcacccgcgcgaagctcgccgatatcctctccgtgccggtcgcc
gcacggccgaactggaccgaggaggaaatccagcgcgaactcgacaacaatgcgcagggc
attctcggttatgtcgtgcgctgggtcgaccagggcgtcggctgctccaaggtgcccgac
atcaacaatgtcggcctgatggaggaccgcgcgacgctgcgcatctcggcgcagcatatg
gcgaactggctgcatcacggcatcgtcagcgaagcgcagatcgtcgaaaccatgcagcgc
atggcggcgatcgtcgacgggcagaacgccggcgatccgaactatcagccgatggccggc
cgcttcgaggagtcgatcgcctttcaggcggcgctggatctcgtgctcaagggccgcgag
cagccgaacggctataccgagccggtcctgcaccgccgccggctggagctgaaggcgaag
cagggggcataa

DBGET integrated database retrieval system