KEGG   Sinorhizobium meliloti SM11: SM11_chr3707Help
Entry
SM11_chr3707      CDS       T01885                                 

Gene name
recR
Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
smx  Sinorhizobium meliloti SM11
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:smx03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3769749..3770354
Genome map
AA seq 201 aa AA seqDB search
MAKRVTGPEIEKLIQLLAKVPGLGPRSARRAALHLVKKKEQLLGPLAEAMGEAHRKVKIC
SCCGNVDTIDPCTVCTDERRDQAVIIVVEDVADLWALERAGAMNAAYHVLGGTLSPLDGI
GPEDLNIRGLIDRVAKGGVRELIIAVNATVEGQTTAHYITDQLEGMEVRITRLAHGVPVG
GELDYLDEGTLAAALRARTVI
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagcgagtcaccggtccggaaatcgagaaactcatccagctcctggcgaaagtc
ccgggcctcgggccccgttccgcccgccgcgcggcgctgcatctcgtcaagaagaaggag
cagttgctcggcccccttgccgaggctatgggcgaagcccatcgtaaggtcaagatctgc
tcctgctgcggcaatgtcgacaccatcgacccctgcacggtctgcaccgacgaacggcgc
gaccaggcggtgatcatcgtggtcgaggacgtcgccgatctttgggcgctggagcgcgcc
ggcgccatgaatgccgcctatcacgtgctcggcggcacgctgtcgccgctcgacggcatc
gggcctgaggatctgaacataaggggcctcatcgaccgcgtcgccaagggtggcgtgcgc
gagctgatcatcgccgtcaacgcgaccgtcgagggccagacgacggcgcactacatcacc
gatcaactcgaaggcatggaggtgagaatcacgcgcctcgcccatggcgtgcccgtcggc
ggcgagctcgactatctcgacgagggaacgctggccgccgcgcttagggcgagaacggtg
atttga

DBGET integrated database retrieval system