KEGG   Sinorhizobium meliloti SM11: SM11_chr3845Help
Entry
SM11_chr3845      CDS       T01885                                 

Gene name
mutM
Definition
probabable formamidopyrimidine-dna glycosylase protein
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:smx03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3904903..3905808
Genome map
AA seq 301 aa AA seqDB search
MPELPEVETVKRGLAPTMEGALLVRAELRRPDLRFPFPENFANAVAGRRIIALSRRAKYL
MIELEGGDVIIAHLGMSGSFRIEKGPIEAGADPATPGAFHHPRGKDEKHDHVVFHLDGGS
GPARVIYNDPRRFGFMDLARRSALADHVFLRGLGEEPTGNALDAAYLATRFAGKIQPLKA
ALLDQRTIAGLGNIYVCEALWRSGLSPKRSAGTLVDKRGRPKQALIALTERIRAVIADAI
AAGGSSLKDHIQADGSLGYFQHSFSVYDREGEACRTPGCHGTVARIVQAGRSTFYCPHCQ
K
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgccggaattgcccgaggtggaaacggtcaagcgcggactggcgccgacgatggagggt
gcgcttctggtgcgggcggagttgcgccggccggatctgcgctttccgttccccgagaat
ttcgcgaacgcggtcgcgggccgccggatcatcgccctctcgcggcgcgccaaatatctg
atgatcgagctcgagggcggcgacgtcatcatcgcccatctcggcatgtccggctcgttc
cggatcgagaagggcccgatagaggctggtgcggatccggccacgcccggcgctttccac
cacccgcgcggcaaggacgagaagcacgatcatgtcgtcttccatctcgatggcggctcc
gggccggcacgggtgatctataacgatccgcgtcgcttcggtttcatggatctggcacgg
cgctctgcgctcgccgaccacgtcttcctccgcggcctcggcgaggagccgaccggcaat
gccctcgatgccgcctatctcgccacccgtttcgccggcaagatccagccgctgaaagcc
gctcttctcgaccagaggacgatcgcggggctcggaaatatctatgtttgcgaggcgctg
tggcgctcgggcctctcgccgaaaaggtcggcaggcacgctcgtcgacaagcggggccgc
ccgaaacaggcgctgatcgcgctgacggaaaggatccgcgccgtgattgccgatgcgatc
gccgccggcggctcctcgctcaaggatcacattcaggcggacggcagtctcggctatttc
cagcacagcttctccgtctatgacagggaaggcgaggcttgccgcacgcccggctgccac
ggtacggtcgcccgcatagtacaggcgggacgttcgactttttactgtccgcactgccag
aaatag

DBGET integrated database retrieval system