KEGG   Sinorhizobium meliloti SM11: SM11_chr3845Help
Entry
SM11_chr3845      CDS       T01885                                 

Gene name
mutM
Definition
probabable formamidopyrimidine-dna glycosylase protein
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:smx00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    SM11_chr3845 (mutM)
Enzymes [BR:smx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     SM11_chr3845 (mutM)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     SM11_chr3845 (mutM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3904903..3905808
Genome map
AA seq 301 aa AA seqDB search
MPELPEVETVKRGLAPTMEGALLVRAELRRPDLRFPFPENFANAVAGRRIIALSRRAKYL
MIELEGGDVIIAHLGMSGSFRIEKGPIEAGADPATPGAFHHPRGKDEKHDHVVFHLDGGS
GPARVIYNDPRRFGFMDLARRSALADHVFLRGLGEEPTGNALDAAYLATRFAGKIQPLKA
ALLDQRTIAGLGNIYVCEALWRSGLSPKRSAGTLVDKRGRPKQALIALTERIRAVIADAI
AAGGSSLKDHIQADGSLGYFQHSFSVYDREGEACRTPGCHGTVARIVQAGRSTFYCPHCQ
K
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgccggaattgcccgaggtggaaacggtcaagcgcggactggcgccgacgatggagggt
gcgcttctggtgcgggcggagttgcgccggccggatctgcgctttccgttccccgagaat
ttcgcgaacgcggtcgcgggccgccggatcatcgccctctcgcggcgcgccaaatatctg
atgatcgagctcgagggcggcgacgtcatcatcgcccatctcggcatgtccggctcgttc
cggatcgagaagggcccgatagaggctggtgcggatccggccacgcccggcgctttccac
cacccgcgcggcaaggacgagaagcacgatcatgtcgtcttccatctcgatggcggctcc
gggccggcacgggtgatctataacgatccgcgtcgcttcggtttcatggatctggcacgg
cgctctgcgctcgccgaccacgtcttcctccgcggcctcggcgaggagccgaccggcaat
gccctcgatgccgcctatctcgccacccgtttcgccggcaagatccagccgctgaaagcc
gctcttctcgaccagaggacgatcgcggggctcggaaatatctatgtttgcgaggcgctg
tggcgctcgggcctctcgccgaaaaggtcggcaggcacgctcgtcgacaagcggggccgc
ccgaaacaggcgctgatcgcgctgacggaaaggatccgcgccgtgattgccgatgcgatc
gccgccggcggctcctcgctcaaggatcacattcaggcggacggcagtctcggctatttc
cagcacagcttctccgtctatgacagggaaggcgaggcttgccgcacgcccggctgccac
ggtacggtcgcccgcatagtacaggcgggacgttcgactttttactgtccgcactgccag
aaatag

DBGET integrated database retrieval system