KEGG   Sinorhizobium meliloti SM11: SM11_chr3846Help
Entry
SM11_chr3846      CDS       T01885                                 

Definition
probabable enoyl coa hydratase protein
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:smx00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    SM11_chr3846
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SM11_chr3846
   00650 Butanoate metabolism
    SM11_chr3846
  Lipid metabolism
   00071 Fatty acid degradation
    SM11_chr3846
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SM11_chr3846
   00310 Lysine degradation
    SM11_chr3846
   00360 Phenylalanine metabolism
    SM11_chr3846
   00380 Tryptophan metabolism
    SM11_chr3846
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SM11_chr3846
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SM11_chr3846
   00281 Geraniol degradation
    SM11_chr3846
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SM11_chr3846
   00627 Aminobenzoate degradation
    SM11_chr3846
   00930 Caprolactam degradation
    SM11_chr3846
Enzymes [BR:smx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SM11_chr3846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3905866..3906639
Genome map
AA seq 257 aa AA seqDB search
MSYETLLVETQGRVGLITLNRPQALNALNAVLMRELDAALKAFDADRAVGAIVLAGSEKA
FAAGADIKEMQGLDFVDGYLADFLGGWEHVANARKPMIAAVSGFALGGGCELAMMCDFII
ASETAKFGQPEITLGVIPGMGGSQRLTRAVGKAKAMDLILTGRMMDAAEAERSGLVSRVV
APDRLLEEALGAAEKIASFSLPAAMMAKEAVNRSLELTLAEGLRFERRLFQSLFATEDQK
EGMAAFVAKRKAEFKHR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagttacgagacgttgctggtcgaaacgcagggccgcgtgggcctgatcacgctcaac
cgtccgcaggcgctcaatgcgctgaatgcggtgctgatgcgcgagctcgatgccgcgctg
aaggccttcgacgccgacagggccgtcggcgccatcgtccttgccggctccgagaaggcc
tttgccgccggcgccgacatcaaggagatgcaggggctcgatttcgtcgacggttacctc
gccgatttccttggcggctgggagcatgtcgcgaacgcccgcaaaccgatgatcgccgcc
gtatccggtttcgcgctcggcggtggctgcgagctcgccatgatgtgcgacttcatcatc
gcctccgaaacggcgaagttcggccagccggagattacgcttggcgtcattcccggcatg
ggtggatcgcagcgcctgacccgcgcagtcggcaaggcgaaggccatggacctcattctc
accggccgcatgatggacgcggcggaggcggagcgctccgggctggtttcgcgcgtggtg
gctccggacaggctcctggaggaggcgctcggcgccgcggagaagatcgcgtcattctcg
ctgccggcggcgatgatggccaaggaggccgtcaaccgctctctggaactgacgctcgcc
gagggcctgcgcttcgagcggcggctcttccagtcgcttttcgcaacggaggaccagaaa
gagggcatggccgccttcgtcgccaagcgcaaagccgaattcaaacacagatga

DBGET integrated database retrieval system