KEGG   Sinorhizobium meliloti SM11: SM11_chr3846Help
Entry
SM11_chr3846      CDS       T01885                                 

Definition
(GenBank) probabable enoyl coa hydratase protein
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
smx00071  Fatty acid degradation
smx00280  Valine, leucine and isoleucine degradation
smx00281  Geraniol degradation
smx00310  Lysine degradation
smx00360  Phenylalanine metabolism
smx00362  Benzoate degradation
smx00380  Tryptophan metabolism
smx00410  beta-Alanine metabolism
smx00627  Aminobenzoate degradation
smx00640  Propanoate metabolism
smx00650  Butanoate metabolism
smx00903  Limonene and pinene degradation
smx00930  Caprolactam degradation
smx01100  Metabolic pathways
smx01110  Biosynthesis of secondary metabolites
smx01120  Microbial metabolism in diverse environments
smx01130  Biosynthesis of antibiotics
smx01212  Fatty acid metabolism
Module
smx_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:smx00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SM11_chr3846
   00650 Butanoate metabolism
    SM11_chr3846
  Lipid metabolism
   00071 Fatty acid degradation
    SM11_chr3846
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SM11_chr3846
   00310 Lysine degradation
    SM11_chr3846
   00360 Phenylalanine metabolism
    SM11_chr3846
   00380 Tryptophan metabolism
    SM11_chr3846
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SM11_chr3846
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SM11_chr3846
   00281 Geraniol degradation
    SM11_chr3846
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SM11_chr3846
   00627 Aminobenzoate degradation
    SM11_chr3846
   00930 Caprolactam degradation
    SM11_chr3846
Enzymes [BR:smx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SM11_chr3846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEH81072
UniProt: F7X5A8
Position
3905866..3906639
Genome map
AA seq 257 aa AA seqDB search
MSYETLLVETQGRVGLITLNRPQALNALNAVLMRELDAALKAFDADRAVGAIVLAGSEKA
FAAGADIKEMQGLDFVDGYLADFLGGWEHVANARKPMIAAVSGFALGGGCELAMMCDFII
ASETAKFGQPEITLGVIPGMGGSQRLTRAVGKAKAMDLILTGRMMDAAEAERSGLVSRVV
APDRLLEEALGAAEKIASFSLPAAMMAKEAVNRSLELTLAEGLRFERRLFQSLFATEDQK
EGMAAFVAKRKAEFKHR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagttacgagacgttgctggtcgaaacgcagggccgcgtgggcctgatcacgctcaac
cgtccgcaggcgctcaatgcgctgaatgcggtgctgatgcgcgagctcgatgccgcgctg
aaggccttcgacgccgacagggccgtcggcgccatcgtccttgccggctccgagaaggcc
tttgccgccggcgccgacatcaaggagatgcaggggctcgatttcgtcgacggttacctc
gccgatttccttggcggctgggagcatgtcgcgaacgcccgcaaaccgatgatcgccgcc
gtatccggtttcgcgctcggcggtggctgcgagctcgccatgatgtgcgacttcatcatc
gcctccgaaacggcgaagttcggccagccggagattacgcttggcgtcattcccggcatg
ggtggatcgcagcgcctgacccgcgcagtcggcaaggcgaaggccatggacctcattctc
accggccgcatgatggacgcggcggaggcggagcgctccgggctggtttcgcgcgtggtg
gctccggacaggctcctggaggaggcgctcggcgccgcggagaagatcgcgtcattctcg
ctgccggcggcgatgatggccaaggaggccgtcaaccgctctctggaactgacgctcgcc
gagggcctgcgcttcgagcggcggctcttccagtcgcttttcgcaacggaggaccagaaa
gagggcatggccgccttcgtcgccaagcgcaaagccgaattcaaacacagatga

DBGET integrated database retrieval system