KEGG   Sinorhizobium meliloti SM11: SM11_pC0807Help
Entry
SM11_pC0807       CDS       T01885                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
smx  Sinorhizobium meliloti SM11
Brite
Enzymes [BR:smx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     SM11_pC0807 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSmeSM11c:complement(727548..728219)
Genome map
AA seq 223 aa AA seqDB search
MKPMNEEHLAVLRRHMVEVVAIYADLASEELGKAALDERVMAAMLRVPRHLFVPAQAAPF
AYQDMPLPIGFDKTVSQPFMVALMTDLLAPKPHEAVLEIGTGLGYQTAILAQLAGKIWSV
EIIEEFASHAEALLHGLGMSNVGIRIGDGSRGWPEHAPFDKILVTAAAEEPPPALLEQLK
PMGRLVLPVGSEEQVLTVIDKDSEGQFLARQLIPVRFSKLEAV
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgaagccaatgaacgaagagcacctcgccgttctgcgcaggcacatggtcgaggtggtc
gcaatctatgccgaccttgcaagtgaagaactcggcaaggcggcgctcgatgaacgggta
atggcagcgatgctgcgggtaccgcggcatctgttcgtgcccgcccaagctgcgcccttt
gcctaccaggacatgccgcttccgatcggcttcgataaaaccgtgtcgcagcccttcatg
gtcgcactcatgaccgatctccttgctcccaaaccgcatgaggccgtgcttgagatcggc
accggcctgggctatcaaaccgcaatcctcgctcaactcgccgggaagatttggagcgtc
gagatcattgaggaattcgcaagccatgccgaggctctcctgcacggcctcggcatgtct
aatgtcggcattcgtatcggcgacggttcacgcggctggcctgagcacgctccattcgac
aagatcctggtcacggcggcggctgaggagccgcctccggctttgctcgagcagctcaag
ccaatgggccgccttgttcttcctgtgggttcggaagaacaggtgctgactgtcatcgac
aaggattcggaagggcaattcctggcgcggcaactcatcccggttcggttcagcaagctc
gaggcggtctaa

DBGET integrated database retrieval system