KEGG   Sinorhizobium meliloti SM11: SM11_pC1351Help
Entry
SM11_pC1351       CDS       T01885                                 

Gene name
adhA1
Definition
Alcohol dehydrogenase, Zn-dependent class III
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:smx01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:smx00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:smx00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:smx00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:smx00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:smx00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSmeSM11c:complement(1243861..1244889)
Genome map
AA seq 342 aa AA seqDB search
MAQTMKAAVVRQFRAPLTIEEMEVPTPGAGQVLVKYEATGVCHTDLHAANGDWPVKPAPP
FIPGHEGVGFVSAVGAGVRRVKEGDKVGVPWLHTACGYCTYCRTGWETLCASQSNTGYSV
NGTFAEFGLADPEFVGKIPDGLEFGAAAPVLCAGVTVYKGLKETEVRPGEWVAISGVGGL
GHMAVQYAKAMGMHVVAADIFEDKLALAKQLGADIAINGKSEDAIEQVQKATSGGVHGVL
VTAVSPAAMEQAFGFLRSKGTMVLVGLPPGMMSLPVFETVLKRITVRGSIVGTRQDLEES
LVFAAEGKVKPYFSWESLENINDIFHRMEAGKIDGRIVVRLQ
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggcacagacaatgaaggcggctgtcgtacgccagttccgcgctccgctgaccatagag
gagatggaagtcccaacgcctggcgcggggcaggtcctggtaaaatatgaagcgacgggc
gtgtgccataccgatctgcatgcggcaaacggcgattggcccgttaagccggccccgccc
tttattccagggcatgagggtgttggcttcgtctcagccgtgggcgccggcgtgaggaga
gtgaaagaaggtgacaaggttggggtgccatggctccacaccgcttgcggttactgtacc
tattgccggaccggttgggaaacgctgtgcgcttcgcaatcgaacaccgggtactcagtg
aacggcaccttcgcggagttcggactggcagatcccgagttcgtcggaaagattcctgat
gggttggaattcggagccgccgcgcccgttctctgcgcgggagtgaccgtctacaagggg
ctgaaggaaacggaagtccgtcccggtgaatgggtggccatctcgggcgtcgggggtctc
ggccacatggcggtgcaatatgccaaggcaatgggaatgcacgtagtggccgccgacata
ttcgaagacaagctggcgctggctaagcaacttggcgccgacatcgcaataaacggcaag
tcagaagatgcaatcgagcaggtacagaaggccacgagcggcggcgttcacggagtgctc
gtgaccgctgtctctcccgccgccatggaacaggcctttggtttcctgcggtcgaaaggt
acgatggtcttggtcggccttccccccggaatgatgtccttgccggttttcgagaccgtc
ctgaaacgcataaccgtgcgtggatcaatcgtgggcacccgtcaagaccttgaggaatcg
ctcgtgttcgcggcggaaggcaaggtaaagccttatttctcgtgggagagcctcgagaac
atcaacgacatctttcatcgcatggaagcgggcaagatcgacggtcgcatagtcgtgcga
ttgcaatag

DBGET integrated database retrieval system