KEGG   Sinorhizobium meliloti SM11: SM11_pC1665Help
Entry
SM11_pC1665       CDS       T01885                                 

Definition
hypothetical protein
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smx00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SM11_pC1665
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SM11_pC1665
Enzymes [BR:smx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     SM11_pC1665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSmeSM11c:1546602..1548041
Genome map
AA seq 479 aa AA seqDB search
MNTTSFFSDMLQSIAERGRRFLSLGPARNGDVNPVGTMEALCDTLLSSRGEASGMALAKN
ILDRWQGFDQDKRRDFMLALLSRFGPDIERLERAIDAYRADPTPKALLEMSMAAEPRRQE
LIRRLNLAPNGIATLVRMRADLLELKAQNPDLEAVDTDFAHLFGSWFNRGFLVLRLISWS
TPADILEKIIRYEAVHHIGGWDELRRRLAPEDRRCFAFFHPQLVDDPLIFVEVALTREMP
PNIADLLKEDRAPIRATDATTAVFYSISNCQEGLRGISFGNFLIKQVVEDLRRDLPRLDT
FVTLSPVPGFADWLSRERQTEASNALSAADRSRLAALDEPDWADQPEIAAAIQPSLTAAA
AWYFLRARNLHGKTVDPVARFHLGNGARLERINFLGDRSERAMRQAHGLMVNYLYKLDDI
ETNHEAFATRGEVVAAPAIRRLIPADRSSRSLVPGPDVFPPGVRSADAPGRKGDKEFTS
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgacgtcatttttcagcgacatgctgcagagcattgccgagcgcggccggcga
ttcctgtcgctcggtccggcccgaaacggcgatgtcaatccggtcggcaccatggaagcg
ctctgcgacacgctgctgtcgagccggggcgaggcgtcgggcatggcgctggccaagaac
attctggatcgctggcaaggcttcgatcaggacaagcggcgcgatttcatgttggcgctg
ctctctcgtttcggccctgatatcgaacggctggagcgggcgatcgacgcctatcgcgcc
gatccgacgccgaaggcgctgctcgagatgagcatggcggcagaaccgcgccgccaggaa
ttgatccgcaggctcaaccttgcgccgaacggcatcgcgaccctcgtccgcatgcgggcg
gacctcctcgaacttaaagcccaaaaccccgatctggaggcggtcgatacggacttcgcg
catctcttcggatcctggttcaatcggggcttcctcgtgctgcggctgatcagctggtcg
acgccggccgacattctggaaaagatcattcgctacgaggccgtccatcatatcggcggc
tgggacgagttgcgccggcggcttgcgccggaggaccggcgctgcttcgccttctttcat
ccgcagctggtcgacgacccgctgatcttcgttgaagtggcgctgacacgcgaaatgcct
cccaacatcgcggacctgctgaaggaggatcgtgctccgatccgcgctactgacgcgacg
acagccgtcttctattccatttcgaactgtcaggaaggcctcaggggcatctccttcggc
aacttcctgatcaaacaggtggtggaggatctgcggcgcgacctccctcgcctcgacacc
ttcgtgacgctgtcgccggtgccgggctttgccgattggttgtcgcgcgaacgccagacg
gaagcgtccaacgccctgtcggccgccgatcgcagcaggcttgcggcgctcgacgagcct
gattgggccgatcagccggagatcgcggcagccatccagccaagccttacggctgcggcc
gcctggtatttcctcagggcccgcaatctccacggcaagacagttgatcccgttgcccgg
ttccatctcggcaatggcgcgcggctggaacgcatcaatttcctaggcgaccggtccgaa
cgggccatgcgccaggcccacgggctgatggtcaactatctttacaagctcgacgacatc
gagactaaccacgaggcatttgcaacccgtggcgaggtcgtcgccgcacctgcgatccgc
cggctgatcccggccgacagaagttcacgtagcctcgttccgggtccggacgtttttccc
ccgggcgtccgatcagctgacgcaccaggaaggaaaggtgacaaggagttcacttcatga

DBGET integrated database retrieval system