KEGG   Sinorhizobium meliloti SM11: SM11_pD0054Help
Entry
SM11_pD0054       CDS       T01885                                 

Gene name
melA
Definition
MelA protein
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:smx00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:smx00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:smx00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSmeSM11d:61941..63413
Genome map
AA seq 490 aa AA seqDB search
MASFKIAIIGAGSIGFTKKLFTDILSVPELRDVEFALTDLSEHNLAMIKSILDRIVEANE
LPTRVTATTDRRKALEGARYIISCVRVGGLEAYADDIRIPLKYGVDQCVGDTICAGGILY
GQRNIPVILDFCKDIREVAEPGAKFLNYANPMAMNTWAAIEYGKVDTVGLCHGVQHGAEQ
IAEILGARDGELDYICSGINHQTWFVDVRLNGRKVGKDELVAAFEAHPVFSKQEKLRIDV
LKRFGVYSTESNGHLSEYLPWYRKRPDEISRWIDMSDWIHGETGGYLRYSTETRNWFETE
YPRFLEEAGRPLETIRRSNEHASRILEALETGRVYRGHFNVKNNGVITNLPADAIIESPG
FVDRFGINMVAGITLPEACAATCISSVNVQRMSVHAAITGDIDLLKLAVLHDPLVGAICT
PEEVWQMVDEMVVAQAKWLPQYAHAIDAAKERLARATVATREWKGAARREVRSIEEIRAE
KEAAKLRAAG
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggccagcttcaagatcgccatcatcggcgccggcagcatcggcttcaccaagaagctc
ttcaccgacattctttccgtgccggagctccgggacgtcgagttcgcgttgacggatctg
agcgagcacaacctcgccatgatcaagtctatcctcgaccggatcgtcgaggcgaacgaa
ctgcccacgcgggtgacggcgacgaccgaccgccgcaaggcgctggaaggtgcgcgctac
atcatcagctgcgtgcgcgtcggcggcctcgaggcctatgccgacgatattcgcattcca
ttgaagtacggcgtcgaccaatgcgtcggcgacacgatctgcgccggcggcatcctctac
ggccagcgcaacattccggtgatcctggatttctgcaaggacatccgcgaggtggctgag
cccggcgccaagttcctcaactatgccaacccgatggcgatgaacacctgggcggcgatc
gaatacggcaaggtcgacacggtcggtctctgccacggcgtccagcacggggccgagcag
atcgccgagattctcggcgccagggacggggagctcgactacatctgctccggcatcaac
caccagacatggttcgtcgatgtccgtctcaacggccgcaaggtcggcaaggacgaactc
gtcgccgccttcgaggcacatcccgtcttttccaagcaggagaagctccggatcgacgta
ttgaagcgcttcggcgtctattcgaccgaaagcaacggacatctgtccgaatacctgccc
tggtaccgcaagcgtccggacgagatctccaggtggatcgacatgtcggactggatccac
ggggagaccggcgggtatctccgctattcgaccgagacccgcaactggttcgagaccgaa
tatccgcgcttcctcgaagaggcgggccggccgctggaaacgatcaggcgctcgaacgaa
catgcgagccgcatcctcgaagcgctcgagacgggtcgggtctatcgcggccacttcaac
gttaagaacaacggcgtgatcaccaacctgccggcagatgcgatcatcgaatcccccggc
ttcgtcgatcggttcggcatcaacatggtggcaggcatcacgttgccggaggcctgtgcg
gccacctgcatctcgtcggtcaacgtccagcgcatgtccgttcatgcggcgatcaccggc
gacatcgatctcctgaagctcgccgtgctgcacgacccgctggtcggcgccatctgcacg
ccggaggaagtctggcagatggtcgacgaaatggtggtcgcgcaggccaaatggctgccg
caatatgcccatgcaatcgacgcggccaaggaaaggctcgcccgcgccacggtcgccacc
cgggagtggaagggcgccgcgcgtcgcgaggtgcgctcgatcgaggagatccgcgcggag
aaggaagcggcgaagctgcgcgctgcggggtag

DBGET integrated database retrieval system