KEGG   Sinorhizobium meliloti SM11: SM11_pD0464Help
Entry
SM11_pD0464       CDS       T01885                                 

Gene name
glpK
Definition
probabable glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smx00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    SM11_pD0464 (glpK)
Enzymes [BR:smx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     SM11_pD0464 (glpK)
Exosome [BR:smx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SM11_pD0464 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSmeSM11d:477304..478869
Genome map
AA seq 521 aa AA seqDB search
MRKAYAGFRSHSGRSFQSRAEEGHMGGYILAIDQGTTSTRAIVFDGNQKIAGVGQKEFKQ
HFPKSGWVEHDPEEIWQTVVSTVKEAIEKSGITANDIAAIGITNQRETVVVWDRETGKPI
HNAIVWQDRRTAAFCDKLKKKGLEKTFVKKTGLLLDPYFSGTKLTWLLSNVKGAQARAAK
GELCFGTIDTFLIWRLTGGKCFCTDATNASRTLLYNIAENAWDDELTEILRVPKEMLPEV
KDCAADFGVTDPSLFGAAIPILGVAGDQQAATIGQACFKPGMLKSTYGTGCFALLNTGKD
MVRSKNRLLTTIAYRLDGETTYALEGSIFVAGAAVQWLRDGLKVIKAAPDTGSLAESADP
SQEVYLVPAFTGLGAPHWDPDARGAIFGMTRNTGPAEFARAALEAVCYQTRDLLEAMHKD
WRRNGNDTVLRVDGGMVASDWTMQRLSDLLDAPVDRPVILETTALGVAWLAGSRAGVWPN
QEAFAKSWARDRRFEPHMDEATRKVKLKGWRSAVKRTLIAA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
gtgaggaaagcgtatgcgggcttccgctcgcattccggtcggtcctttcaatcgcgtgcc
gaggaggggcatatgggcggatatattctcgcgatcgatcagggcacgacgtccacgcgc
gcgatcgttttcgacggcaaccagaaaatcgcgggcgtcgggcagaaagagttcaagcag
cactttccgaagtcaggctgggtggagcacgatccggaggagatctggcagacggtcgtc
agcacggtcaaggaagcgatcgagaagtccggcatcaccgcgaacgatattgccgcgatc
ggcatcaccaaccagcgggagacggttgtcgtctgggatcgcgagaccggcaagccgatc
cacaatgccatcgtctggcaggaccgccgcactgccgccttctgcgacaagctcaagaag
aagggactggaaaagaccttcgtgaagaagaccggtctgctgctcgatccctatttttcg
ggaacgaagctcacatggctgctttccaatgtgaagggcgcgcaggcgcgcgcagccaaa
ggggaactctgcttcggcaccatcgacaccttcctaatctggcggctgacgggcggcaag
tgcttctgcaccgacgcgacgaatgcctcgcgtaccctcctatacaatatcgccgagaat
gcctgggacgacgagctcaccgagatcctgcgcgtgccgaaggagatgctgccggaagtg
aaggactgcgcggccgacttcggcgtcacggatccgtctctcttcggcgcggcgatcccg
atcctcggcgttgccggcgaccagcaggcggcaacgatcggtcaggcctgtttcaagccg
ggcatgctgaaatcgacctacggtacgggctgcttcgctttgctcaacaccggcaaggac
atggtccgctcgaagaaccgccttctgaccaccatcgcctaccgcctcgacggtgaaacg
acctatgcgctcgaaggctcgatcttcgtagccggtgctgccgtgcaatggctgcgcgac
gggctcaaggtgatcaaggcggcgcccgatacgggctcgcttgccgagagcgccgatccc
tcgcaggaggtctatctggtgccggccttcaccggcctcggagcgccccattgggatccg
gatgcgcggggcgcgatcttcggcatgacgcgcaataccggcccggcagagttcgcacgg
gcggcactcgaggccgtctgctaccagacccgcgacctgctggaggccatgcacaaggat
tggcgccgtaacggcaatgatacggtcctgcgcgtcgatggcggcatggtcgcctccgac
tggacgatgcagcgcctgtcggacctgctcgacgctccggtcgaccgaccggtcattctc
gaaaccaccgcgctcggcgtcgcgtggcttgcaggcagccgcgccggcgtctggccaaac
caggaggcgttcgccaagtcctgggcccgcgaccgccgcttcgagccgcatatggacgag
gccacgcgcaaggtgaagctcaagggctggcgcagcgcagtcaagcggacgttgattgct
gcctga

DBGET integrated database retrieval system