KEGG   Sinorhizobium meliloti SM11: SM11_pD0507Help
Entry
SM11_pD0507       CDS       T01885                                 

Gene name
lacZ2
Definition
putative beta-galactosidase protein
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:smx00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SM11_pD0507 (lacZ2)
Enzymes [BR:smx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SM11_pD0507 (lacZ2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSmeSM11d:525766..527772
Genome map
AA seq 668 aa AA seqDB search
MPLTSPNHFNSDARTPGRLELGVCYYPEQWPRGKWAEDARRMVELGLSWVRIGEFAWAKI
EPRSGEFHWEWLDEAIDVLGKAGLKVILGTPTAAPPKWLVNRYPEILPVDATGAVRKFGA
RRHYCFSSRRYRSEAARITEAMARRYGEHIYVHAWQTDNEYGDHDTIYSYSAEAVGAFRL
WLAERYGSIDELNRAWGTSFWSMRYDSFEEIDLPNNLVEEPSPTHGVDFIRFSSDQVKSF
NKAQVDIIRALSPGRPVTHNFMSQNTDFDHYRVGEDIDIASWDVYPMGGLLNGRLAAKDK
EHYLRVGDPDQPAFNHDLYRAVGRGRVWVMEQQPGPVNWAAHNQSPADGMVRLWTWLAYA
HGVDMVSYFRWRQAPFAQEQFHAGLLLPNSEADQGYLEVAEVVAEMKRLPEGEVRGKAQV
AIVLDYESRWATRVLPQGRSYSASAVALDWYSTVARLGVDVDFIGQHSDIAGYKLILAPD
LVIAEEAFVERLTRADAKVVFGARSGSKTRDMHIPEGLPPGPLAKLIDISVSRVESLPEF
HSETVLYGNEAYEAGGWRETVRTSETVIASFDGEYRNGAPALVGSDKARYLAVAANGALL
DKVIGDALGWAGLESLPDLGDLRVTRRGNLRFAFNFGRIPAEVPAGASAEFYVGGRTLKP
VDVAIWRE
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgccgctgactagccccaatcacttcaactccgacgcacggacgcctggcaggcttgag
ctcggcgtgtgctactacccggaacaatggccgcgcgggaaatgggcggaggacgcccgg
cgaatggtcgagctcggcctctcctgggttcgcatcggtgagttcgcctgggcgaaaata
gagccgcggtcgggcgaatttcattgggaatggctggacgaggcgatcgatgttctgggc
aaggccggcctcaaggtcatcctcggcacgccgacggcggccccgccgaaatggctcgtg
aaccgctatcccgagattctgccggtggacgcgaccggagcggtgcgcaaattcggcgcg
cgacgccactattgcttctcgagtcggcgttaccgctccgaggcggcgcgcatcaccgag
gcgatggcgcgccgctatggcgaacacatctatgtccatgcctggcagacggacaatgaa
tatggcgaccacgacacgatctacagctattccgccgaggcggtcggggcgttccgcttg
tggctggccgaacgctacggctcgatcgatgagctgaaccgcgcctggggcacctcattt
tggtcgatgcgctacgatagcttcgaggaaatcgacctgccgaacaatctcgtggaggag
ccgagccccacccacggggtggatttcatccgcttctcttccgatcaggtgaagagcttc
aacaaggcgcaggtcgacatcatccgggcgctttcgcccgggcgaccggtgacgcacaac
ttcatgtcgcagaacaccgatttcgatcattacagggtgggcgaggacatcgacatcgcc
tcctgggacgtctatccgatgggcggcctgcttaacggacggctcgcagcgaaggacaag
gagcattatctccgggtcggggatcccgaccagccggccttcaaccacgatctctaccgc
gccgtcggccgcggccgcgtctgggtcatggagcagcagccggggccggtgaactgggcg
gcgcacaaccagtcccccgccgacggcatggtgcggctctggacgtggctcgcctatgcc
catggggtcgacatggtctcctatttccgctggcggcaggcgcctttcgcgcaggaacag
tttcacgcgggcctccttcttccaaacagcgaggcggaccagggctatcttgaagtcgcc
gaagtcgtcgctgaaatgaagcgcctgcccgagggagaggtgcgtggcaaggcgcaggtc
gcgattgttctcgactacgaatcgcgctgggccacacgcgtcttgccgcaggggcggagc
tattccgcttcggcggttgcgctcgactggtattcgacggtggcccgcctcggcgtcgat
gtggatttcataggacagcactccgatatcgccggatacaagctgatccttgccccggat
ctcgtgatcgccgaggaggccttcgtcgagcggctcacgcgagcggatgccaaggtggtc
ttcggcgcgcgcagcggcagcaagacgagggacatgcacatccccgagggactaccacca
ggaccgctggcgaagctcatcgatatcagcgtctcgcgggtcgagtcgctgccggagttt
cacagcgagactgttctctatggcaacgaggcctatgaggcgggcggttggcgcgagacg
gtcaggacgagcgaaactgtcatcgcaagcttcgacggggagtatcgtaacggcgcgccg
gcgctcgtcggcagcgacaaggcacgctacctggcggttgcggccaacggcgcattgctc
gacaaggtgatcggcgacgcgctcggctgggctgggttggaaagcctgcccgacctcggc
gatcttcgcgtgacgcgccgtggcaatctccgtttcgccttcaatttcggccggatcccc
gcggaggttcccgcgggcgcctcggccgagttctacgtgggaggccgcacgctaaaaccc
gtcgatgttgcgatctggagggaatga

DBGET integrated database retrieval system