KEGG   Sinorhizobium meliloti SM11: SM11_pD0514Help
Entry
SM11_pD0514       CDS       T01885                                 

Gene name
exoN
Definition
UDPglucose pyrophosphorylase protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:smx00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SM11_pD0514 (exoN)
   00052 Galactose metabolism
    SM11_pD0514 (exoN)
   00500 Starch and sucrose metabolism
    SM11_pD0514 (exoN)
   00520 Amino sugar and nucleotide sugar metabolism
    SM11_pD0514 (exoN)
Enzymes [BR:smx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SM11_pD0514 (exoN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSmeSM11d:complement(533669..534574)
Genome map
AA seq 301 aa AA seqDB search
MDRVRTVRKAVIPVAGNGTRFLPATKAVPKEMLTIVDRPVVQYAVDEARQAGIEHIVFVT
SRNKQVIEDHFDDAPELISSLSRSGKSAQISELEAMLPAAGSVSFTRQQAPLGLGHAVWC
ARDLIGDEPFALLLPDMVSFGARGCVAGLMDLYHEVGGNVVGVEQCAPEEASKYGIVGKG
ETVRHGFSVTEMVEKPAAGKAPSNYYLNGRYILQPEIFSILAHQTRGAGNEIQLTDGMLT
LSQSQSFHAHPYEGRTFDCGSKQGFIEANVAFALARADIGDIVFESVRDMVLSHESRIRA
A
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggaccgtgtcaggaccgtcagaaaagcagtaatcccagttgccggaaacggaacgagg
ttccttccggcgacgaaggcagtgcccaaggagatgttgacgatcgtcgaccggccagtc
gttcagtatgccgtggacgaggcccgccaggccggcatcgagcatatcgtcttcgtcacc
agccggaacaagcaggtgatcgaggaccatttcgacgacgcgccggagctcatctcgtca
ctttcacgttccggcaaaagcgcgcagatttccgaactcgaggccatgttgccggcagcc
ggctcggtcagctttacccgtcagcaggcccccctcggcctcgggcacgcggtatggtgt
gcgcgtgacctgatcggcgacgagcccttcgcgcttctgctgccggacatggtctccttc
ggcgcgcgcggttgcgtggccggtctcatggacctctatcacgaggttggcggcaacgtc
gtcggcgtcgagcaatgcgcccccgaggaagcatcgaaatacggcatcgtcggcaagggc
gagacggtccggcacggtttctccgtgaccgagatggtcgaaaagcccgccgccggaaag
gcgccgtccaactactatctcaacggccgctacatccttcagccggaaatcttctcgatt
ctggcccatcaaacgcgcggcgccggcaatgagatacagttgaccgatggcatgctgacg
ctttcgcaatcccagtccttccacgcgcatccctatgagggccgcaccttcgactgcggt
tcgaagcagggcttcatcgaagccaatgtcgccttcgcccttgctcgtgcggacatcggc
gatatcgttttcgaatccgtccgcgacatggttctgtctcacgaaagccgcatccgggcg
gcataa

DBGET integrated database retrieval system