KEGG   Sinorhizobium meliloti SM11: SM11_pD1004Help
Entry
SM11_pD1004       CDS       T01885                                 

Gene name
rmlC2
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:smx00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:smx00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSmeSM11d:1076256..1076840
Genome map
AA seq 194 aa AA seqDB search
MSLVVIRSLGLDGVLEILPGRIEDERGFFSETWNERKLAEAGIALHFVQDNHSFSAAKGV
LRGLHHQLSPYAQDKLVRVIRGAIFDVAVDIRRGSPTFAQWVAAEVSARKWNQILIPKGF
SHGFLTLEPNTEVIYKVTNPYSPAYDRSIRFDDPEIAIAWPLPVAEFQLSGKDAAAPPLG
QAELFNFPVEGARL
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcgtcgtcatcagatcgcttggcctcgacggggtcctggagatcctgccgggc
aggatcgaggacgaacgtggcttcttctctgaaacttggaacgagcgcaaattagccgaa
gccgggatcgcgttgcacttcgttcaggacaatcattccttctcggccgcgaaaggcgtc
ctgcgcggacttcaccaccaactctcaccctacgcgcaggacaagctggtcagggtgata
agaggcgccatcttcgacgtcgcagtggacattcgccgtggctcgccaaccttcgcgcaa
tgggtcgcggccgaggtttccgctcgcaagtggaaccaaatcctgatcccaaagggtttt
tcgcacggcttcctgacgctcgaaccgaacacggaggtgatctacaaggtcaccaaccca
tattcaccagcttacgatagatcgatccgttttgacgatcccgagatcgcaatcgcctgg
ccactgccagttgccgaattccagctgtctggcaaggacgcggcggctccgccgctgggg
caagccgaactgttcaacttcccggtggagggggcccggctatga

DBGET integrated database retrieval system