KEGG   Sinorhizobium meliloti SM11: SM11_pD1112Help
Entry
SM11_pD1112       CDS       T01885                                 

Definition
putative methyltransferase
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:smx00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SM11_pD1112
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    SM11_pD1112
Enzymes [BR:smx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     SM11_pD1112
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     SM11_pD1112
Two-component system [BR:smx02022]
 CheA family
  CheA-CheYBV
   SM11_pD1112
Bacterial motility proteins [BR:smx02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    SM11_pD1112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSmeSM11d:complement(1180536..1184021)
Genome map
AA seq 1161 aa AA seqDB search
MGRELDPPIVAIGASAGGIQALQTFFDLIPNDTGATFVVIVHLDPHARSELANILAARTR
MSVTQVEDQARLEGNHVYVIAPNRQLKIADGTITALPFEEPHALRAPIDLFFRSLAEEHG
SELAVILTGAGADGAIGVKAVKEAGGIVLVQDPEEAEYASMPRNAIDTEVADFVLPIREL
PHRVAELLADRDQLPSEPFHADDDDMIGRILAHVRGRTGHDFSQYKRATILRRIGRRAQI
ARRETFADYYNYLRENPEEAQALFSDFLISVTTFFRDPSAFEALAERVIPQLFDGKEVAD
AIRVWVPGCATGEETYTMGMLLLEEAARRDLSPEIQVFGSDLDAQALRIAREGRYPSTIE
SDLSEERLRRFFQREGDHYRVRRELRDVVLFASHSLLRDPPFSHLDMISCRNLLIYLDRQ
LQQQVCNTFHYALNAGGFLFLGSSESADHPGLFLTVDREARIYRAVAGGGARRPMVLPAL
LGPHKPEIKSTIIRMPAAGHVSDAAVHRQMLEKIAPPSMLVDESHHAIHLSENAGRFLQP
SGGPVSTDATDLVREEFRFDLRAALHRAFERNEPTLSMPILADLDGQPHRVYLQVKPVVQ
GTERTRHALVLFIEGEAIDKTQEVVLDTLDGRPTIDEAIRRLQEELQLAQNRLRLTSEES
ATATEELRAANEELQSMNEEYRSTAEELETSKEELQSINEELQTVNSELKLKLESISRAH
SDLQNLMAATDIATLFLDPSLRIKRFTPRLTEIFNVTPSDEGRPITDFTHHLKYKRLSDD
ARAVLETLTPVEHEVKSRDDGWYLVRMRPYRTMEDKIDGVVVTFVDISERRHAEEAAKES
GQRLEQEMRLVELSRSPIFVWDFDDGIMQWNRGSEELYGYSREEALGRRKEELLKTAVPG
SSFDKLRRTLSQKGRWSGELNHTTKDGRVLTVESQIELVPFGERRLVLESTRDISDRKRW
ERRGQLLLNELSHRVKNTLAVVQSLARQTLRTTRSSEDFVERFEGRLAALASAHKLLVDS
EWRGAELDALARGQLDAYAGSDRRRLQIEGEPVTLPPDLATPFGLVLHELATNAAKYGAF
STGIGQVRLSWKLGNNGRNLGVIWQERGGPPVEPPSEQGFGGVLIEKSLPGSTVHRDFQP
DGVVCTIDIELPEIPPDGAEK
NT seq 3486 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgagaattggatcctccgattgtcgcaatcggagcctctgcgggtggcattcag
gctcttcagaccttctttgatcttataccgaatgacacgggcgccaccttcgtcgtcatt
gtccatctcgatccgcacgccagaagcgagcttgcgaacattttggcggcacggacgcgc
atgtcggttacacaggtcgaggaccaagcgcgccttgaaggcaaccacgtatacgtcatt
gcgccgaaccgtcagcttaagattgccgacggtacgataaccgcgctccccttcgaagag
ccgcatgccctccgggcgcctattgatcttttctttcggtcgctcgccgaggagcatggg
agcgaacttgcggtcattctcactggtgccggggcggacggtgcgattggggtgaaggct
gtcaaggaggcgggcggaatcgtgctcgtccaggatcctgaagaggcagaatatgcctcc
atgccgcgcaatgccatcgacactgaggttgcagacttcgtgctgcctatccgggagctt
cctcatcgggtggctgagttgctcgccgatcgtgatcaacttccgtccgagccgttccac
gcagacgatgacgatatgatcgggcgaattctcgcccatgtgcgcggccgaaccggacac
gatttctcccaatacaagcgggctacgattttgcggcgtatcggacggcgagcgcaaatt
gccaggcgggagacctttgcggactactacaactacctgcgtgagaatcccgaagaagcc
caggcgctgttcagcgactttttgatttcggttacgacgttctttcgcgatccctcggct
ttcgaggctcttgccgaacgagtcatcccgcaattgtttgacggaaaagaagtcgccgac
gcgatcagggtctgggttccgggctgcgccaccggtgaggaaacctatacgatgggcatg
cttctgcttgaggaggcggcacgccgcgacctttcgccggaaatccaggtcttcggctca
gacctcgacgcacaggcactgcgcatcgcgcgcgaaggacgatacccatcgactatcgaa
agcgatctctcggaggaacgactgcgccggttctttcagcgtgagggagatcactatcga
gtgcgccgcgagttgcgcgatgtggttctctttgccagccacagcttgctcagagacccg
ccgttctcccatctcgatatgatttcctgccgaaacctgctgatctatctcgatcggcag
ctgcagcagcaggtgtgcaatacgtttcattacgcgctcaacgcaggtggctttctcttt
ctcggatcgtcggaaagtgccgaccaccccgggctcttcctcactgtggatcgcgaggca
cgtatctacagggctgtcgcaggcggcggtgctcgacgacccatggtgctgccggcgctg
cttggtccacataagccggaaattaaatcgaccatcattcggatgccggcggcagggcac
gtcagcgacgcagcggtacaccgccagatgctcgagaaaatcgctcctccaagcatgctg
gtcgatgaaagtcaccacgcgattcatctttcggaaaacgccggacgctttctccaaccc
tcaggtggccccgtcagtaccgacgcgacggatctcgtgcgcgaggaatttcgcttcgat
ctaagagcggcgctgcaccgggccttcgagcggaatgagcccacgttgagcatgcccatc
cttgctgacctggacgggcaaccgcaccgcgtctacctgcaagtgaagccggtggtccaa
gggacggaacgcacccggcatgcccttgtgctttttatcgaaggcgaggcaatcgacaaa
acccaggaggtcgtgctcgatacgcttgatgggcgcccgacgatcgacgaggcgatccgc
cgcttgcaggaggagctgcagctcgcgcaaaaccggcttcgcctgaccagcgaggagtcg
gccaccgccaccgaagaactgcgggctgccaacgaagaactgcagtcaatgaacgaggaa
taccgttcgacggccgaggaactggaaacgagcaaggaagagctccaatcgatcaatgag
gagctgcaaaccgtcaacagtgagctcaaactgaagctggaaagcatatcgcgggctcac
agcgacttgcagaacttgatggccgcgaccgacatcgcgacgcttttcctcgacccgtcc
cttcgtatcaagcgttttaccccgcggctgacggagatattcaacgtcacgccgagcgac
gaaggccggccgatcactgatttcacgcatcatcttaaatataagagactttctgatgac
gcacgcgcggtgctcgagacgctcacgccagtcgagcacgaggtgaagagccgcgatgac
ggctggtatctggtgcggatgcgcccctaccgcacgatggaagacaagatagacggcgtt
gtggtgaccttcgtcgacatcagcgagcggcgccatgccgaagaggcggcgaaggagagc
gggcaacgccttgagcaggaaatgcggctcgtcgagctttcccgctcaccgatattcgtg
tgggactttgacgatggcataatgcagtggaaccgcggcagcgaggaactctatggctat
tcgcgtgaggaggcgcttggaaggcgcaaggaagaactgctaaagacggccgttcccggc
tcgtcctttgacaagctcaggcgaacactcagccaaaagggccgttggagcggcgaactg
aaccataccacgaaggacggtcgagtgctgacggtagagagccagatcgagctcgtgccg
tttggcgagcgccggcttgtgctggaaagcacccgcgacatttccgaccgcaaacgctgg
gagcggcgcgggcagctcttgctgaacgagctaagccatcgggtgaagaacacgctcgct
gtcgtccagtcgctggcgcgccagacgctccgcacaacccgatcgagcgaggacttcgtc
gagcgctttgaagggcgcctcgcagcacttgcgagtgcccataagctgcttgtcgattct
gaatggcgcggcgccgagcttgacgcactggcgcgagggcaactcgatgcctacgccggc
agcgatcggcgccgactgcagatcgagggcgagccagtgacgctgccgccggacctcgct
acaccgttcggtctcgtgctccacgagctcgcgaccaatgccgcgaaatacggcgcgttt
tctactggaatcggacaggtcaggctcagttggaaactcgggaacaacggccggaacctt
ggggttatctggcaagaacgcggtggcccgccggttgagcctccgagcgagcagggtttc
ggcggcgttctgatcgagaagagcttgccaggatctacggttcatcgcgatttccaaccg
gatggcgtcgtctgcacgatcgacatcgagcttccggagatcccgccagatggcgcggaa
aagtga

DBGET integrated database retrieval system