KEGG   Sinorhizobium meliloti SM11: SM11_pD1431Help
Entry
SM11_pD1431       CDS       T01885                                 

Definition
putative cytochrome c protein
Orthology
K08738  
cytochrome c
Organism
smx  Sinorhizobium meliloti SM11
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:smx00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SM11_pD1431
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SM11_pD1431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSmeSM11d:complement(1515531..1515941)
Genome map
AA seq 136 aa AA seqDB search
MAFRLGTLLTAFVLFGGTLGAAAPALALDPSVGDPGAGEKVFRKCQACHAVGPDAKSKTG
PLLNGIIGRSAGKAEGYAYSPAMSKAAEAGLTWTPEKIAEFLTSPKGFLPGTKMTFAGLR
KDQERADIIAYLATFP
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggcttttagacttggtaccctgttgaccgctttcgtcctgttcggtggaactcttggc
gctgctgcgccggctcttgccctggatccctcggtcggagatcccggggcaggcgagaaa
gtcttccgcaagtgtcaggcctgtcacgccgtcggtccggatgccaaatcgaagaccgga
cccttgctgaacgggataatcggccggtcggccggcaaagccgaaggctacgcctactcg
ccggcgatgagcaaggcggccgaggcaggacttacctggacgccggagaagatcgctgag
tttctgacgagtccgaagggcttcctacccggcaccaagatgacctttgcgggtctgcgc
aaggatcaggagcgcgccgatataatcgcgtatctggcaacctttccctga

DBGET integrated database retrieval system