KEGG   Stenotrophomonas maltophilia D457: SMD_0025Help
Entry
SMD_0025          CDS       T02061                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
smz  Stenotrophomonas maltophilia D457
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:smz00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SMD_0025
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMD_0025
  Lipid metabolism
   00071 Fatty acid degradation
    SMD_0025
  Amino acid metabolism
   00350 Tyrosine metabolism
    SMD_0025
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SMD_0025
   00626 Naphthalene degradation
    SMD_0025
Enzymes [BR:smz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SMD_0025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(29964..30992)
Genome map
AA seq 342 aa AA seqDB search
MNSTMKAAVVREFGKPLVIEEVSVPRPGAGEVLVRIEACGVCHTDLHAAEGDWPVKPNPP
FIPGHEGVGHVVAVGGGVGHVKEGDRVGIPWLYSACGHCEHCLGGWETLCETQRNTGYSV
NGGFAEYALADANYVGLLPKDVGFVEIAPVLCAGVTVYKGLKVTDTKPGDWVAISGIGGL
GHMAVQYARAMGLNVAAVDVDDNKLALARQLGAQITVNARTTDPAAFLRKEIGGAHGALV
TAVSPKAFEQALGMVRRGGTVSLNGLPPGNFPLDIFGMVLNGITVRGSIVGTRLDLQESL
QFAAEGKVAATVSTDRLENINDVFARMHAGTIEGRVVLDFAA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaattcgaccatgaaggccgctgtcgtgcgtgagttcggcaagccactggtgatcgag
gaagtctcggtaccacgcccgggggcgggcgaggtactggtcaggatcgaggcctgtggc
gtctgccacaccgacctgcacgccgccgagggcgactggccggtgaaaccgaacccgccg
ttcatccccggccacgagggcgtggggcacgtcgtggccgtgggaggcggggtagggcac
gtcaaggaaggcgacagggtcggcatcccctggttgtactcggcgtgtggccattgcgaa
cactgcctgggtggctgggaaacgctgtgcgagacacagcgcaataccggttactcggtc
aacggcggcttcgccgagtacgcactggccgatgccaactatgtcggcctgcttccgaag
gacgtgggcttcgtcgagatcgcaccggtgctgtgcgccggcgtgaccgtctacaagggc
ctgaaggtcaccgacaccaagcccggcgactgggtggcgatttccggcatcggtggcctg
ggccacatggcggtgcagtacgcccgtgcgatgggcctgaacgtggctgcggtggacgtg
gacgacaacaagctggcattggcccggcagctgggtgcgcagatcaccgtgaacgcgcgc
accaccgatccggccgccttcctcaggaaggagatcggcggcgcgcacggcgccctggtc
acggcggtctcaccgaaggcgttcgagcaggcgctgggcatggtccgccgtggcggcacc
gtctcgctcaacggcctgccgcccggcaatttcccgctggatatcttcggcatggtgctc
aacggcatcaccgtgcgcggctcgatcgtcggcacccggctggacctgcaggagtcgctg
cagttcgccgccgaaggcaaggtcgcggccaccgtcagcaccgaccgcctggagaacatc
aacgacgtgttcgcgcgcatgcacgcgggcaccattgagggccgcgtggtactcgacttc
gccgcctga

DBGET integrated database retrieval system