KEGG   Stenotrophomonas maltophilia D457: SMD_0038Help
Entry
SMD_0038          CDS       T02061                                 

Definition
Fatty acid desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
smz  Stenotrophomonas maltophilia D457
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:smz00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    SMD_0038
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    SMD_0038
Enzymes [BR:smz01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     SMD_0038
Lipid biosynthesis proteins [BR:smz01004]
 Desaturase
  First
   SMD_0038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
44455..45657
Genome map
AA seq 400 aa AA seqDB search
MPDALMSLLTGGVLGLGWWAMLAVLLVFTQITIFSVTLYLHRSQAHRGVDFHPALAHVFR
FWLWLTTSMITREWVAIHRKHHAKVETEDDPHSPVTRGIGRVFWHGVELYREARGMRADI
EQYGRGTPDDAIERHLYTPHATLGPVLLLVINSVLFGLPGVALWAIQMAWIPFWAAGVVN
GLGHWWGYRNYESADTSTNLTPWGFWIGGEELHNNHHAFPSSARFAMRRWEFDIGWSAIR
LLQALRLAKVLRVAPAMDVRPNIAVPDAETLKALLSHRFQAMTDYQRNVFMPALREEAAQ
AGAKLRRLLPRRLRRGLVNDGRWLKPDSRAQLSAWVAQRPRIRTLVEYRARLAALLEARG
HDAAERLHQLQAWCREAEESGIAALQAYAARLKGYSLVGA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgcctgatgccctgatgtccctgttgaccggtggtgtgctcggcctggggtggtgggcc
atgctggcagtgctgctggtcttcacccagatcaccatcttctcggtgaccctgtacctg
caccgcagccaggcccatcgcggggtcgatttccacccggcgctggcccacgtgttccgt
ttctggctgtggctgaccacctcgatgatcacccgcgagtgggtggccatccatcgcaag
caccacgccaaggtggagaccgaggacgacccgcacagcccggtcacccgcggcatcggc
agggtgttctggcacggcgtggagctgtaccgggaggcacgcggcatgcgcgcggacatc
gaacagtacgggcgcggtaccccggacgatgcgatcgagcgccacctgtataccccgcac
gccacgctgggcccggtgctgctgctggtgatcaacagcgtgctgttcggcctgcccggc
gtggccctgtgggcgatccagatggcatggatcccgttctgggcggccggcgtggtcaac
ggcctgggccactggtggggctaccgcaactacgagtctgccgatacctccaccaatctc
acgccgtgggggttctggatcggtggcgaggagctgcacaacaaccaccatgccttcccc
agctcggcgcgcttcgcgatgcggcgctgggaattcgacatcggctggagtgcgatccgc
ctgctgcaggcgctgcgcctggccaaggtgctgcgggtggcaccggccatggacgtgcgt
ccgaacatcgccgtgcccgatgccgagacccttaaggcgctgctgtcgcaccgcttccag
gcgatgaccgactaccagcgcaatgtgttcatgccggccctgcgcgaggaagccgcccag
gccggagccaagctgcgccgcctgctgccgcgccggctgcgccgtggactggtcaacgat
ggtcgctggctgaagccggacagccgtgcccagctcagcgcatgggtggcacagcgcccg
cgcatccgcaccctggtcgagtaccgcgcgcggctggcggcgttgctggaagcccgaggc
cacgatgccgccgagcgcctgcaccagttgcaggcgtggtgccgcgaggccgaggaaagc
ggtatcgcggcgttgcaggcctacgccgcacgcttgaagggctacagcctggtgggcgcg
tga

DBGET integrated database retrieval system