KEGG   Stenotrophomonas maltophilia D457: SMD_0199Help
Entry
SMD_0199          CDS       T02061                                 

Gene name
mls
Definition
(GenBank) Malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
smz  Stenotrophomonas maltophilia D457
Pathway
smz00620  Pyruvate metabolism
smz00630  Glyoxylate and dicarboxylate metabolism
smz01100  Metabolic pathways
smz01110  Biosynthesis of secondary metabolites
smz01120  Microbial metabolism in diverse environments
smz01200  Carbon metabolism
Module
smz_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:smz00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SMD_0199 (mls)
   00630 Glyoxylate and dicarboxylate metabolism
    SMD_0199 (mls)
Enzymes [BR:smz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SMD_0199 (mls)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: CCH10800
Position
244094..245716
Genome map
AA seq 540 aa AA seqDB search
MSAVASAVPTPASKATPGIALATRVAGQDTVLPAPLLALLVSLHRAVEPGRQARLQARRE
RQAFFDQGGLPDFREDTAAIRSGDWRVAPLPAALQDRRVEITGPTDPKMVINALNSGAKV
FMADFEDSTSPTWRNLLAGQRSLAAAVRGDLDYTAPNGKHYTLRPHDEQAVLIVRPRGWH
LDEKHVRIDGQFIAGGLFDAAVFAFHNARTLQAKDRGPYFYLPKLQSMEEAALWETALSH
IEGMLGLPHGQIKVTVLIETLPAVFEMDEILHALRDRIVGLNCGRWDYIFSYLKTFRRHA
DRVLPERGQVTMTQPFLKAYSELLIQTCHRRGAHAMGGMAAQIPINNDAAANEQAMARVR
ADKLREVTAGHDGTWVAHPALIPVAMAIFDEHMPGANQHSVLRQDVCVGRDELIARPPGT
ITRAGFEGNVEVCVRYLAAWLDGNGCVPIHHLMEDAATAEISRSQLWQWLHTPGQQLDDG
TAIDLALLDATLAQLPARLGDTATLPGGARIGEAIALLGELSRSDELTDFLTLPAYARID
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccgtcgcttccgctgttcccacccctgccagcaaggctacccccggcatcgcc
ctggcgacccgcgtggccggccaggacaccgtgctgccggcgccgctgctggccctgctg
gtgtcgctgcaccgtgcggtggaaccgggccggcaggcacggctgcaggcgcgccgcgag
cgccaggcgttcttcgaccagggcggcctgccggacttccgcgaggacaccgctgcgatc
cgtagcggcgactggcgcgttgcgccgctgccggccgcgctgcaggaccgccgcgtcgag
atcaccggcccgaccgatccgaagatggtcatcaacgcgctgaactccggcgccaaggtg
ttcatggccgacttcgaggattcgacctcgccgacctggcgcaacctgctggccgggcag
cggtcgctggccgccgcggtgcgtggcgatctcgactacaccgcccccaatggcaagcac
tacacgctgcgcccgcatgacgagcaggcggtgctgatcgtgcgcccgcgtggctggcac
ctggacgaaaagcacgtgcgcatcgatggccagttcatcgccggcggcctgttcgacgcg
gcggtgttcgccttccacaacgcccgcaccctgcaggcgaaggaccgcggcccgtacttc
tacctgcccaagctgcagagcatggaagaggcggcgctgtgggaaacagcgctgtcgcac
atcgaaggcatgctcggcctgccgcacggccagatcaaggtaaccgtgctgatcgaaacg
ctgccggcggtgttcgagatggatgagatcctgcacgcgctgcgtgaccgcatcgtcggc
ctgaactgtgggcgctgggactacatcttctcgtacctgaagaccttccggcgccacgcc
gaccgcgtgctgcccgagcgcggccaggtgaccatgacccagccgttcctgaaggcctat
tcggaactgctgatccagacctgccatcgccgtggtgcacatgcgatgggtggcatggcc
gcgcagattccgatcaacaacgatgccgccgccaacgaacaggcgatggcccgcgtgcgc
gctgacaagctgcgcgaagtgaccgccggccacgacggcacctgggtcgcgcatccggcg
ctgattccggtggcgatggcgatcttcgacgaacacatgcccggtgcgaaccagcacagc
gtgctgcgccaggatgtgtgcgtcggccgcgacgaactgatcgcacggccgcccggcacc
atcacccgcgccggcttcgaaggcaacgtggaagtctgcgtgcgctacctggcggcatgg
ctggatggcaacggctgcgtgccgatccaccacctgatggaggacgcggccaccgccgag
atcagccgcagccagttgtggcagtggctgcatacgccgggccagcagctggacgatggc
accgccatcgacctggcactgctggatgccacgctggcacagctgccggcacggctgggt
gacaccgccacgctgcccggtggcgcacgcatcggcgaggccatcgccctgctcggcgaa
ctgagccgcagcgacgaactgaccgatttcctgaccctgccggcctacgcgcgcatcgac
tga

DBGET integrated database retrieval system