KEGG   Stenotrophomonas maltophilia D457: SMD_0323Help
Entry
SMD_0323          CDS       T02061                                 

Gene name
algC
Definition
(GenBank) Phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
smz  Stenotrophomonas maltophilia D457
Pathway
smz00010  Glycolysis / Gluconeogenesis
smz00030  Pentose phosphate pathway
smz00051  Fructose and mannose metabolism
smz00052  Galactose metabolism
smz00230  Purine metabolism
smz00500  Starch and sucrose metabolism
smz00520  Amino sugar and nucleotide sugar metabolism
smz00521  Streptomycin biosynthesis
smz01100  Metabolic pathways
smz01110  Biosynthesis of secondary metabolites
smz01120  Microbial metabolism in diverse environments
smz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:smz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMD_0323 (algC)
   00030 Pentose phosphate pathway
    SMD_0323 (algC)
   00051 Fructose and mannose metabolism
    SMD_0323 (algC)
   00052 Galactose metabolism
    SMD_0323 (algC)
   00500 Starch and sucrose metabolism
    SMD_0323 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    SMD_0323 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    SMD_0323 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SMD_0323 (algC)
Enzymes [BR:smz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     SMD_0323 (algC)
    5.4.2.8  phosphomannomutase
     SMD_0323 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV Phage_holin_3_6
Motif
Other DBs
NCBI-ProteinID: CCH10922
Position
375882..378167
Genome map
AA seq 761 aa AA seqDB search
MLLILLAGWFGWSAVQQWRQEANGQALEEARDQAVQGLQQAAAGQLQQLQQQLKNDRVQQ
ALQAGDAAAAALAVRESGTGVEQVEVLAADLANAYADPATFGYSRLALLEAALAEARPSL
RVVRDGGGNRLGLAAPVQLGSLGPAVIYVRQPLLRLTSPLDQVSAPSAGFLGLRQGAFDL
VTQGDPSLAESAEALARPVAGTPLRLVASVPNVEAGPLGLGALASAIVALLLAFIAVLLV
VGRDRLPKSLPLPRRAAASEADHGPTLSESLQQAPPPVAAATGSGDATPPPPPPVPAEEL
AAGIFRAYDIRGMVGSELTPKTAALIGQAIGTVALEQGLREVVIGRDGRLSGPELTAGLA
EGLRRAGCAVIDIGLAPTPLVYYAAFHLRTGTCVAVTGSHNPPEYNGFKVVIGGETLSGD
AITDLYQRIVEGRLVQSAEPGDYQQRDVSADYIQRIADDVQLDRPLKVVADAGNGVAGAL
APQLLEAIGADVIPLYCDVDGTFPNHHPDPSEPANLEDLVQTVKRFGADLGVAFDGDGDR
LGVVTGEGRIIYADRLLMLFAADVLMRNPGAMVIYDVKCTGKLSDHVLRNGGSPLMWKTG
HSLMKAKMRETDAELAGEMSGHFFFKERWFGFDDGLYAAARLLEILAQREETPDEVLGEL
PEMVATPELKVAVADGTPHALVAMLVAAAQSPDNPYVGGRLSTIDGLRVDFADGWGLVRA
SNTTPVLVLRFEGNDEAALERIKALFRSQLQPVLGDTPLGF
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
gtgctgttgatcctgttggccggctggttcggatggagcgcggtgcagcaatggcggcag
gaggccaacgggcaggcgctggaagaggcgcgtgaccaggccgtgcagggcctgcagcag
gctgctgcgggccagttgcagcagctgcagcagcagttgaagaacgatcgcgtgcagcag
gcgctgcaggccggcgacgccgctgcggcggcgctggccgttcgcgagagcgggaccggg
gtcgagcaggtcgaggtgctggcggccgatctggccaacgcctatgccgatccggccacc
ttcgggtattcccgcctggcgctgctggaagcggcgctggccgaggccaggccaagcctg
cgcgtggtccgcgacggcggcggcaaccgcctgggcctggccgcgccggtgcagctgggc
agcctggggccggccgtcatctatgtccgccaaccgctgctgcggctgacgtcgccgctc
gaccaggtcagcgcgccgtccgccggcttcctcggcctgcgccagggagcattcgatctg
gtcacccagggcgacccgagcctggccgaaagcgcggaagcgctggcgcgcccggttgca
ggcacgccgttgcggctggtcgcgtcggtgccgaatgtcgaggccggtccgctcggcctg
ggcgcgctggccagcgccattgtggcgttgctgctggcgttcattgccgtgttgctggtg
gtggggcgcgaccggctgccgaagtcgctgccgttgccgcgccgcgccgccgcgtccgag
gccgaccatggcccgaccctgagcgagagcctgcagcaggcgccgccaccggtggccgcc
gcgaccggcagtggcgatgccacgccaccgccgccaccgccggtgcctgccgaagagctg
gccgccggcatcttccgcgcctatgacatccgcggcatggtgggcagcgaactgacaccg
aagaccgcggcgctgatcggccaggccatcggcaccgtggcactggagcagggcctgcgc
gaggtggtgatcgggcgcgatggccgcctgtccggacccgagctgacggccgggctggcc
gagggcctgcgccgtgccggctgcgcggtgatcgacatcggcctggcgccgaccccgctc
gtgtactacgccgccttccatctgcgtaccggcacctgcgtggcggtcaccggcagccac
aacccgcccgagtacaacggcttcaaggtggtgatcggcggcgagacgctgtccggcgat
gcgatcaccgacctctaccagcgcatcgtcgagggccgcctggtgcagtccgccgagccg
ggtgactaccagcagcgcgatgtcagtgccgactacatccagcgcatcgccgatgacgtg
cagctggaccgtccgctgaaggtcgtggccgatgccggcaatggcgtggccggcgcactg
gccccgcagctgctggaagcaatcggcgccgacgtcattccgctgtactgcgatgtcgat
ggcaccttccccaaccatcatcccgacccgagcgagccggccaacctggaagacctggtg
cagacggtcaagcgcttcggcgccgacctcggcgtagccttcgatggcgacggcgaccgg
ttgggcgtggtcaccggcgaaggcaggatcatctatgccgaccgcctgctgatgctgttc
gctgccgacgtgctgatgcgcaatccgggcgcgatggtgatctacgacgtcaagtgcacc
ggcaagctgtccgaccatgtgctgcgcaacggtggcagcccgctgatgtggaagaccggg
cattcgctgatgaaggcgaagatgcgcgagaccgatgccgagctggccggtgagatgagc
ggccacttcttcttcaaggaacgctggttcggtttcgacgacggcctgtacgccgctgcg
cgcctgctggagatcctggcccagcgcgaggaaaccccggacgaagtactgggcgaactg
ccggagatggtcgccacgccggagctgaaggtagcggtggccgacgggacgccgcatgcg
ttggtggcgatgctggtggcggcggcgcagtcgccggacaacccgtatgtggggggccgc
ctgtcgaccatcgatggcctgcgcgtggacttcgccgatggctggggcctggtgcgcgcc
tccaacaccacgccggtgctggtgctgcggttcgaaggcaacgacgaggccgcactcgag
cgcatcaaggccttgttccgcagccagctgcagccggtgctgggcgacaccccgctgggg
ttctga

DBGET integrated database retrieval system