KEGG   Stenotrophomonas maltophilia D457: SMD_0546Help
Entry
SMD_0546          CDS       T02061                                 

Gene name
rmlC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
smz  Stenotrophomonas maltophilia D457
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smz00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    SMD_0546 (rmlC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SMD_0546 (rmlC)
Enzymes [BR:smz01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     SMD_0546 (rmlC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
624119..624676
Genome map
AA seq 185 aa AA seqDB search
MKVIETKLPGCVVIEPAVFGDARGYFFETWNAERFAALGLPDRFVQSNVSTSAQGVLRGL
HYQWPRPQGKLVSVLEGEVYDVAVDIRRGSPTFGQWEAVVLSAENKKQFWIPEGFAHGFA
VLSERAVFSYLCTEVYLKDFDAGVRWNDAGIAVDWPVSAPTLSAKDENAPFLKDIAEDRL
PVYVP
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagtgattgaaaccaagttgcccggctgcgtggtgatcgagccggcggtgttcggc
gacgcccgcggttatttcttcgaaacctggaacgccgagcgcttcgccgcgctgggcctg
ccggaccgtttcgtgcagagcaacgtgtcgacctctgcgcagggcgtgctgcgcggcctg
cattaccaatggccgcggccgcagggcaagctggtcagcgtgctggaaggcgaggtctat
gacgtggcagtggatatccgccgcggttcgccgaccttcggccagtgggaagcggtggtg
ttgagcgcggagaacaagaagcagttctggatcccggagggctttgcccatggctttgcc
gtgttgtccgagcgtgcggtgttcagctacctgtgcactgaggtgtacctcaaggacttc
gatgccggcgtgcgctggaacgatgcaggcatcgccgtggactggccggtcagtgcaccg
accttgtcggccaaggacgagaacgcacccttcctgaaggacattgctgaagaccgccta
ccggtctacgtgccatga

DBGET integrated database retrieval system