KEGG   Stenotrophomonas maltophilia D457: SMD_0574Help
Entry
SMD_0574          CDS       T02061                                 

Gene name
dsbC
Definition
Thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
smz  Stenotrophomonas maltophilia D457
Brite
Enzymes [BR:smz01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     SMD_0574 (dsbC)
Secretion system [BR:smz02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   SMD_0574 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
650837..651622
Genome map
AA seq 261 aa AA seqDB search
MLRFAIAAVFGALSLTACAQPAPPAAKAPAAAAAKASPAANAPADQAVRAALTALNPGFQ
VDYIGAAPFPGFREVVVSGQLLYVSDDGRYLFQSQPYDTRAKGPANSEGLLGYRRGLLAK
ANHGDRIVFAAPNAKYTISVFTDIECGYCRKLHQDIAELNRNGITVEYLAFPRMGLGSKD
YTDMISVWCAADRRQALTNAKRGGSVPARNCTNPVAMQYALGQQLGVNGTPAIFAPDGTQ
LGGYLPPAQLRAALEKLSAKR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgctccgatttgccatcgccgccgtgttcggtgcgctcagcctgaccgcctgcgcccag
ccggctccgccggccgccaaggcgcctgctgccgctgcggccaaggccagcccggccgcc
aacgcgccggccgaccaggcggtacgtgccgcgttgaccgcgctcaatccgggtttccag
gtcgattacatcggtgccgcgccgttccccggcttccgcgaggtcgtcgtttccggccag
ctgctgtacgtgtccgatgacggccgctacctgttccagtcgcagccttacgacacccgc
gccaagggcccggccaacagcgagggcctgcttggttaccgccgcggcctgctggccaag
gccaaccacggcgatcgcatcgtgtttgccgctccgaacgccaagtacaccatcagcgtg
ttcaccgacatcgagtgtggttactgccgcaagctgcaccaggacatcgccgaactcaac
cgcaacggcatcaccgtcgagtacctggcgtttccgcgcatgggcctgggcagcaaggac
tacaccgacatgatctcggtctggtgtgcagcggatcgtcgccaggccctgaccaacgcc
aagcgcggtggcagcgtgccggccaggaactgcaccaacccggtggcgatgcagtacgcg
ctgggccagcaactgggcgtgaatggaacgccggcgatcttcgcgccggatggcacccag
ctgggcggctacctgccgccggcgcagctgcgtgccgcgctggagaagctgtcggccaag
cgctga

DBGET integrated database retrieval system