KEGG   Stenotrophomonas maltophilia D457: SMD_0683Help
Entry
SMD_0683          CDS       T02061                                 

Gene name
tesA
Definition
Arylesterase precursor (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
smz  Stenotrophomonas maltophilia D457
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:smz00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    SMD_0683 (tesA)
Enzymes [BR:smz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     SMD_0683 (tesA)
   3.1.2  Thioester hydrolases
    3.1.2.-  
     SMD_0683 (tesA)
Lipid biosynthesis proteins [BR:smz01004]
 Fatty acid synthase
  Component type
   SMD_0683 (tesA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
791235..792548
Genome map
AA seq 437 aa AA seqDB search
MDVLATLGQAQVVGDQDQGGAAAGVEFEQQVADVLAGGMVQRAGRFVGEQDARAGDEGTC
QRHALLLAAGQLARVVAGAMGQADLRQHLVHPRAVLASGQFQRQRDILGGSQRRQQVEAL
EHEADRARAQLGPCFFIQVAQVLARQRDVAAAGQVQSGQQAEQGGLAGPRSADDGHTGAF
MDGQGDVVQYVDFTLRALHGLADLVDGDGDGRAAGGQAVDEETPMRKTGWSRRAGAMMVL
LLGLLLPGLAGAKDPAGTVLVLGDSLSAAHNIPADAGWVSLLQQRVRQQSKTPARIVNAS
MSGETTAGALTRLPGLLAKEKPTVVVIALGGNDALRGLTPAQVQGNLEKMVQASQKAGAR
VLLLGIDVPPNYGPAYRQRLAAAYKALATQYKVPLLPFLLEGVALQPGMMQADGLHPTAQ
AQSRVLDNVWPLLRPLL
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
gtggatgtactggcaacgctgggccaggcgcaggtcgtgggtgaccaggaccagggtggt
gccgctgccggtgttgagttcgaacagcaggtcgctgatgtgctggccggtggcatggtc
cagcgagccggtcggttcgtcggcgaacaggatgcgcgggcgggtgacgaaggcacgtgc
cagcgccacgcgctgctgctcgccgccggacagctggcgcgggtagtggcgggcgcgatg
ggccaggccgacctgcgccagcacctcgtccacccgcgcgcggtcctcgcgtccggccag
ttccaacggcagcgcgacattctcggcggcagtcagcgccggcagcaggtggaagctctg
gaacacgaagccgaccgcgcgcgcgcgcagctgggcccgtgcttcttcatccaggtcgcc
caggttctggcccgccagcgcgacgtggccgcggctgggcaggtccagtccggccagcag
gccgagcagggtggtcttgccggaccccgaagcgccgacgatggccacactggtgccttc
atggacggtcagggtgatgttgtccagtatgtggacttcaccctccgggccctgcacgga
cttgccgacctggtcgacggcgatggcgacgggcgtgctgcggggggacaggctgtcgat
gaggagactccaatgcgcaagacgggatggagccggcgagccggcgcgatgatggtgctg
ctgctgggattgctgctgcccgggctggccggagccaaagacccggcaggtacggtgctg
gtgctcggcgacagcctcagtgctgcccacaatatccctgccgacgccggctgggtcagc
ctgttgcagcagcgggtcaggcaacagtcgaaaacaccggcgcgcatcgtcaatgccagc
atgagcggggaaaccacggccggcgcgctgacccgcctgccgggcctgttggcgaaggaa
aagccgacggtggtggtgatcgcgctgggcggcaacgacgcgctgcgcgggctgaccccg
gcacaggtgcagggcaacctggaaaagatggtacaggccagccagaaggccggcgccagg
gtgctgctgctgggcatcgacgtgccgcccaactatgggcccgcttaccgccagcgcctg
gcggcggcctacaaggcgctggccacgcagtacaaggtgccgctgctgccgttcctgctg
gagggcgtggccctgcagccgggcatgatgcaggccgatggcctgcaccccacggcgcag
gcgcaatcgagggtgctggacaacgtctggccactcctgcggcccctgctctga

DBGET integrated database retrieval system