KEGG   Stenotrophomonas maltophilia D457: SMD_0753Help
Entry
SMD_0753          CDS       T02061                                 

Gene name
ipk
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
smz  Stenotrophomonas maltophilia D457
Pathway
smz00900  Terpenoid backbone biosynthesis
smz01100  Metabolic pathways
smz01110  Biosynthesis of secondary metabolites
smz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:smz00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SMD_0753 (ipk)
Enzymes [BR:smz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     SMD_0753 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: CCH11338
Position
859070..859939
Genome map
AA seq 289 aa AA seqDB search
MSAGRDDAGWSWWPAPAKLNLFLHITGRRADGYHELQTVFRLLDWGDRIGLRLREDGQVR
RQGEGLAGVAEADDLAVRAARLLQDEAKGAQGADIIVEKHVPAGGGFGGGSSDAATVLVV
LNRLWRAGLDEDALAALALRLGADVPVFVRGHNAWAEGVGERLQPITLAPAWYVVVEPGV
HVPTPVLFADPDLTRDSPVAKIEDFASGTLVGNAFEPVLRRREPAVEAALAALSDIGAAR
LTGSGSGCFVEFASQAAAEQGRSKLPKELRARVAAGVARSPLLDALEQH
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgggcgcgacgacgcgggctggtcctggtggccggccccggccaagctgaac
ctgttcctgcacatcactggccgccgggccgacggctaccacgagttgcagaccgtattc
cgcctgctggactggggggaccgcatcggcctgcgcctgcgtgaagacggtcaggtgcgt
cggcagggcgagggcttggccggcgtggccgaggccgatgacctggcggtgcgggccgcg
cgcctgctccaggatgaggcgaagggcgcgcaaggtgctgacatcatcgtcgaaaagcac
gttcctgccggtggtggcttcggcggcggttcgtccgatgcggccaccgtgctggtggtg
ctgaatcggctctggcgcgccggcctggacgaggatgccctggccgcgctggccctgcgc
ctgggcgccgacgtgccggtgttcgtgcgtggccacaatgcctgggccgaaggggtgggc
gagcgcctgcagccgatcacgctggcgccggcctggtatgtggtggttgaaccgggtgtt
catgttcctacgccggtcctgtttgcagacccggatttgacgcgcgacagcccagtggcg
aaaatagaggacttcgcttccgggaccctggtcgggaacgcgttcgaaccggtgctgcgc
cgccgtgagcctgccgtcgaggcagcgcttgccgcgttgagcgacatcggcgcggcgcgg
ctgaccggttcgggaagtggttgtttcgtcgagttcgcatcgcaggctgctgcagagcag
gggcggtcgaagttgccgaaggagttgcgggcaagggtggcagcgggcgttgcgcgttcg
ccactgctggatgcactcgagcaacactga

DBGET integrated database retrieval system