KEGG   Stenotrophomonas maltophilia D457: SMD_0833Help
Entry
SMD_0833          CDS       T02061                                 

Gene name
kbl
Definition
2-amino-3-ketobutyrate coenzyme A ligase (EC:2.3.1.29)
Orthology
K00639  
glycine C-acetyltransferase [EC:2.3.1.29]
Organism
smz  Stenotrophomonas maltophilia D457
Pathway
Glycine, serine and threonine metabolism
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:smz00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(941324..942580)
Genome map
AA seq 418 aa AA seqDB search
MPGRISGFPVQSRAHAMTDVSSALTRHYAEELDAIRAQGLFKSERIITSPQSAEITLDDG
RKVLNFCANNYLGLADHPDLIQAAKDALDTHGFGMASVRFICGTQDLHKQLEKQIADFFG
KQDTILYAACFDANGGLFEPLLGENDAIISDALNHASIIDGVRLCKAKRFRYANCDMADL
EAQLQAADAAGCKTKLITTDGVFSMDGFIAPLDEITALAKKYNALVHIDECHATGFLGAT
GRGSAEVKGVLEKIDIITGTLGKAMGGALGGFTCASAEVIELLRQRSRPYLFSNSLPPHV
VAAGIKAFEMLAAADDLRSTLAENTAYFREKMTAAGFDVKPGVHPISPVMLYDAPLAQKF
AERLLEEGIYAIGFFFPVVPKGQARIRTQISAAHSREHLDRAIDAFTRIGVELGVVKG
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgcccggtagaatcagcggtttccccgttcagagccgtgcccacgccatgaccgacgtc
tcctccgccctgacccgccactacgccgaggaactggacgccatccgcgcccagggcctg
ttcaagtccgagcggatcatcaccagcccgcaatcggccgaaatcaccctcgacgacggc
cgcaaggtgctgaacttctgtgccaacaactacctgggtctggccgaccatccggacctg
atccaggccgccaaggacgcactggatacccacggcttcggcatggcctcggtgcgcttc
atctgcggcacccaggacctgcacaagcagctggagaagcagatcgccgatttcttcggc
aagcaggacaccatcctgtacgcggcctgcttcgatgccaacggtggcctgttcgagccg
ctgctcggcgagaacgacgcgatcatttccgacgcgctgaaccatgcttcgatcatcgac
ggcgtgcgcctgtgcaaggccaagcgcttccgatacgccaactgcgacatggccgatctg
gaagcgcagctgcaggccgccgatgccgcaggctgcaagaccaagctgatcaccaccgat
ggcgtattctcgatggacggcttcatcgcgccgctggacgagatcaccgcgctggcgaag
aagtacaacgcgctggtacacatcgacgaatgccacgccaccggcttccttggcgctacc
ggccgtggttcggccgaggtcaagggcgtgctggagaagatcgacatcatcaccggcact
ctgggcaaggccatgggcggcgcgctgggcggcttcacctgcgccagcgccgaggtgatc
gaactgctgcgccagcgctcgcgcccgtacctgttctccaactcgctgccgccgcatgtg
gtggccgccggcatcaaggcgttcgaaatgctggctgccgctgacgaccttcgcagcacg
ctggccgagaacaccgcctacttccgcgagaagatgaccgccgccggtttcgacgtgaag
ccgggcgtgcatccgatcagcccggtaatgctgtatgacgcaccgttggcgcagaaattc
gccgagcgcctgctggaagaaggcatctacgcgatcggcttcttcttcccggtggtgccc
aagggccaggcccgcatccggacccagatcagcgccgcgcacagccgcgagcacctggat
cgcgcgatcgatgcgttcacccgcattggtgtcgaactgggcgtggtcaagggctga

DBGET integrated database retrieval system