KEGG   Stenotrophomonas maltophilia D457: SMD_0833Help
Entry
SMD_0833          CDS       T02061                                 

Gene name
kbl
Definition
2-amino-3-ketobutyrate coenzyme A ligase (EC:2.3.1.29)
Orthology
K00639  
glycine C-acetyltransferase [EC:2.3.1.29]
Organism
smz  Stenotrophomonas maltophilia D457
Pathway
Glycine, serine and threonine metabolism
Brite
KEGG Orthology (KO) [BR:smz00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SMD_0833 (kbl)
Enzymes [BR:smz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.29  glycine C-acetyltransferase
     SMD_0833 (kbl)
Amino acid related enzymes [BR:smz01007]
 Aminotransferase (transaminase)
  Class II
   SMD_0833 (kbl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(941324..942580)
Genome map
AA seq 418 aa AA seqDB search
MPGRISGFPVQSRAHAMTDVSSALTRHYAEELDAIRAQGLFKSERIITSPQSAEITLDDG
RKVLNFCANNYLGLADHPDLIQAAKDALDTHGFGMASVRFICGTQDLHKQLEKQIADFFG
KQDTILYAACFDANGGLFEPLLGENDAIISDALNHASIIDGVRLCKAKRFRYANCDMADL
EAQLQAADAAGCKTKLITTDGVFSMDGFIAPLDEITALAKKYNALVHIDECHATGFLGAT
GRGSAEVKGVLEKIDIITGTLGKAMGGALGGFTCASAEVIELLRQRSRPYLFSNSLPPHV
VAAGIKAFEMLAAADDLRSTLAENTAYFREKMTAAGFDVKPGVHPISPVMLYDAPLAQKF
AERLLEEGIYAIGFFFPVVPKGQARIRTQISAAHSREHLDRAIDAFTRIGVELGVVKG
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgcccggtagaatcagcggtttccccgttcagagccgtgcccacgccatgaccgacgtc
tcctccgccctgacccgccactacgccgaggaactggacgccatccgcgcccagggcctg
ttcaagtccgagcggatcatcaccagcccgcaatcggccgaaatcaccctcgacgacggc
cgcaaggtgctgaacttctgtgccaacaactacctgggtctggccgaccatccggacctg
atccaggccgccaaggacgcactggatacccacggcttcggcatggcctcggtgcgcttc
atctgcggcacccaggacctgcacaagcagctggagaagcagatcgccgatttcttcggc
aagcaggacaccatcctgtacgcggcctgcttcgatgccaacggtggcctgttcgagccg
ctgctcggcgagaacgacgcgatcatttccgacgcgctgaaccatgcttcgatcatcgac
ggcgtgcgcctgtgcaaggccaagcgcttccgatacgccaactgcgacatggccgatctg
gaagcgcagctgcaggccgccgatgccgcaggctgcaagaccaagctgatcaccaccgat
ggcgtattctcgatggacggcttcatcgcgccgctggacgagatcaccgcgctggcgaag
aagtacaacgcgctggtacacatcgacgaatgccacgccaccggcttccttggcgctacc
ggccgtggttcggccgaggtcaagggcgtgctggagaagatcgacatcatcaccggcact
ctgggcaaggccatgggcggcgcgctgggcggcttcacctgcgccagcgccgaggtgatc
gaactgctgcgccagcgctcgcgcccgtacctgttctccaactcgctgccgccgcatgtg
gtggccgccggcatcaaggcgttcgaaatgctggctgccgctgacgaccttcgcagcacg
ctggccgagaacaccgcctacttccgcgagaagatgaccgccgccggtttcgacgtgaag
ccgggcgtgcatccgatcagcccggtaatgctgtatgacgcaccgttggcgcagaaattc
gccgagcgcctgctggaagaaggcatctacgcgatcggcttcttcttcccggtggtgccc
aagggccaggcccgcatccggacccagatcagcgccgcgcacagccgcgagcacctggat
cgcgcgatcgatgcgttcacccgcattggtgtcgaactgggcgtggtcaagggctga

DBGET integrated database retrieval system