KEGG   Stenotrophomonas maltophilia D457: SMD_0966Help
Entry
SMD_0966          CDS       T02061                                 

Gene name
recR
Definition
Recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
smz  Stenotrophomonas maltophilia D457
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:smz00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SMD_0966 (recR)
DNA repair and recombination proteins [BR:smz03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SMD_0966 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1087093..1087692
Genome map
AA seq 199 aa AA seqDB search
MSAPLLEQLIDALRVLPGVGQKTAQRMAYHLLEREREGGQRLAEALALAVERIGHCAQCR
DFSETELCPTCANSSRERSQLCVVESPADRLAIENATGFRGVYFVLQGRLSPLDGIGPRE
LGLEQLEQRLADGEVQELIIATSATVEGEATAHYLAQLARARKVQPSRLAQGLPLGGELE
YVDRGTLSHAFGTRSEFRD
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgcacccctgcttgaacaattgatcgacgcactgcgggtgctgcctggcgtgggc
cagaagaccgcacagcgcatggcctaccacctgctcgagcgcgagcgcgaaggtggccag
cgactggccgaagccctggcgctggcggtggagcgcatcggccactgcgcgcagtgccgc
gacttcagcgaaaccgagctgtgcccgacctgtgccaacagcagccgcgagcgcagccag
ctgtgcgtggtcgaatcgccggccgaccgcctggccatcgaaaacgccaccggcttccgc
ggtgtctacttcgtgctgcagggccggctgtcgccgctcgatggcatcggcccgcgcgag
ctgggcctggagcagctggagcagcgtctggccgacggtgaggtgcaggagctgatcatc
gccaccagtgccaccgtcgaaggcgaagccaccgcgcactacctggcgcagctggcgcgc
gcgcgcaaggtgcagcccagccggctggcacagggcctgccgctcggtggcgagcttgaa
tacgttgaccgcggcacgctgtcgcacgcgttcggaacgcgcagcgaattccgcgattga

  All links  
No link information was found.   
DBGET integrated database retrieval system