KEGG   Stenotrophomonas maltophilia D457: SMD_0966Help
Entry
SMD_0966          CDS       T02061                                 

Gene name
recR
Definition
Recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
smz  Stenotrophomonas maltophilia D457
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:smz03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1087093..1087692
Genome map
AA seq 199 aa AA seqDB search
MSAPLLEQLIDALRVLPGVGQKTAQRMAYHLLEREREGGQRLAEALALAVERIGHCAQCR
DFSETELCPTCANSSRERSQLCVVESPADRLAIENATGFRGVYFVLQGRLSPLDGIGPRE
LGLEQLEQRLADGEVQELIIATSATVEGEATAHYLAQLARARKVQPSRLAQGLPLGGELE
YVDRGTLSHAFGTRSEFRD
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgcacccctgcttgaacaattgatcgacgcactgcgggtgctgcctggcgtgggc
cagaagaccgcacagcgcatggcctaccacctgctcgagcgcgagcgcgaaggtggccag
cgactggccgaagccctggcgctggcggtggagcgcatcggccactgcgcgcagtgccgc
gacttcagcgaaaccgagctgtgcccgacctgtgccaacagcagccgcgagcgcagccag
ctgtgcgtggtcgaatcgccggccgaccgcctggccatcgaaaacgccaccggcttccgc
ggtgtctacttcgtgctgcagggccggctgtcgccgctcgatggcatcggcccgcgcgag
ctgggcctggagcagctggagcagcgtctggccgacggtgaggtgcaggagctgatcatc
gccaccagtgccaccgtcgaaggcgaagccaccgcgcactacctggcgcagctggcgcgc
gcgcgcaaggtgcagcccagccggctggcacagggcctgccgctcggtggcgagcttgaa
tacgttgaccgcggcacgctgtcgcacgcgttcggaacgcgcagcgaattccgcgattga

DBGET integrated database retrieval system