KEGG   Stenotrophomonas maltophilia D457: SMD_1258Help
Entry
SMD_1258          CDS       T02061                                 

Definition
hypothetical protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
smz  Stenotrophomonas maltophilia D457
Brite
Enzymes [BR:smz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     SMD_1258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1398430..1399266)
Genome map
AA seq 278 aa AA seqDB search
MTESHDFFLPGGPQGVLLVHGLTGTPAEMRMLGKGLNNAGFTVHGVQLPGHCGTVDDLLA
TTWEQWYQGVEDAAASLRGKVDQLFVGGLSMGAVLALALAARRPEWVSGVGVYGATFRYD
GWNIPAVARLSFLLPWFKRFNIGRDRMFMEEPPYGLRDERLRAQVSAAMLSGDSAAAGLP
GNPWHALAEMRALSNWTRRHLHQVTAPCLVMHAREDDVASMGNAELVMSRVSGPKELVVL
EDSYHMITIDRERREVIRRSARFFTEIGERSGVLKAVA
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaatcgcacgacttcttccttcccggtggcccgcagggcgtgctgctggtccac
ggcctgaccggcaccccggcggaaatgcgcatgctgggcaagggcctgaacaacgccggc
ttcaccgtacacggcgtgcagttgcccggccattgcggcaccgtggatgacctgctggcg
accacctgggaacagtggtaccagggcgtggaagatgcagcggcgagcctgcgtggcaag
gtcgaccagttgttcgtcggcggcctgtcgatgggcgcggtactggcgctggcgctggct
gcacgccgccccgaatgggtgtccggcgtcggcgtgtatggcgccaccttccgctacgat
ggctggaacattcccgccgtggcccgcctgtcgttcctgctgccctggttcaagcgcttc
aacatcggccgcgaccgcatgttcatggaagaaccgccctacggcctgcgtgacgagcgc
ctgcgtgcgcaggtcagtgccgccatgctgtccggcgacagcgccgcggccggcctgccg
ggcaacccctggcatgcgctggccgagatgcgcgccctgagcaactggacccgccgccac
ctgcaccaggtcaccgcaccgtgcctggtgatgcacgcccgcgaagacgacgtggccagc
atgggcaacgccgaactggtgatgtcgagggtcagcggcccgaaggaactggtggtgctg
gaagacagctaccacatgatcacgatcgaccgcgaacgccgcgaggtgatccgccgcagc
gcgcgtttcttcaccgaaatcggtgaacgcagcggcgtgctcaaggcggtggcctga

DBGET integrated database retrieval system