KEGG   Stenotrophomonas maltophilia D457: SMD_1268Help
Entry
SMD_1268          CDS       T02061                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
smz  Stenotrophomonas maltophilia D457
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:smz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SMD_1268 (gpmA)
   01230 Biosynthesis of amino acids
    SMD_1268 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMD_1268 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    SMD_1268 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SMD_1268 (gpmA)
Enzymes [BR:smz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SMD_1268 (gpmA)
Exosome [BR:smz04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SMD_1268 (gpmA)
  Exosomal proteins of melanoma cells
   SMD_1268 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1410485..1411234
Genome map
AA seq 249 aa AA seqDB search
MTRKLVLLRHGQSQWNLDNRFTGWVDVDLTEQGRREAAAAGRLMREEGLQFDVAHTSVLK
RAIHTLQGALAELEQDWLPVNKSWRLNERHYGGLQGLDKAETAAKHGEEQVKVWRRSYDI
PPPPMDLEDPGHPIHDRRYAGLDRNALPGTESLATTLDRVLPYWHDAIAPQLKDGKTVLV
TAHGNSLRALYKYLNNVSREEILELNIPTGIPLLFELNDDLTVQSFRYLGDPEAARKAAE
AVANQGKAK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
gtgacccgtaaactcgtactgttgcgccatggccagagccagtggaacctggacaaccgc
ttcaccggctgggtcgatgtcgacctgaccgagcaggggcgccgggaagcggccgccgcc
ggtcgcctgatgcgcgaggaaggcctgcagttcgacgtcgcccacacctccgtgctcaag
cgtgccatccacaccctgcagggtgcgctggccgagctggagcaggactggctgccggtg
aacaagtcctggcgcctcaacgagcggcactacggcggcctgcaggggctggacaaggcc
gagaccgcggccaagcacggcgaagagcaggtcaaggtctggcgtcgttcgtacgacatc
ccgccgccgccgatggacctggaagatccgggccacccgatccatgaccgccgctacgcc
ggtctggaccgcaacgcgctgccgggcaccgagtcgctggccaccaccctggaccgcgtg
ctgccgtactggcacgacgccatcgcgccgcagctgaaggacggcaagaccgtgctggtc
actgcccacggcaactcgctgcgcgcgctgtacaagtacctcaacaatgtctcgcgcgag
gagatcctcgagctgaacatcccgaccggcatccctctgctgttcgaactgaacgacgac
ctgaccgtgcagtcgttccgctacctgggcgacccggaagcagcgcgcaaggccgccgaa
gccgtggccaaccagggcaaggcgaagtaa

DBGET integrated database retrieval system