KEGG   Stenotrophomonas maltophilia D457: SMD_1350Help
Entry
SMD_1350          CDS       T02061                                 

Gene name
dapE
Definition
N-succinyl-L,L-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
smz  Stenotrophomonas maltophilia D457
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:smz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SMD_1350 (dapE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    SMD_1350 (dapE)
Enzymes [BR:smz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     SMD_1350 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1510268..1511386
Genome map
AA seq 372 aa AA seqDB search
MLDLTCELIARPSVTPDDAGCQALLAARLKQAGFQCDHLRLGEVDNLWATHGQGAPVLVL
LGHTDVVPTGPREAWASDPFSPQIRDGVLYGRGAADMKGSVAAFVVAAEQFVAAHPDHHG
TLAVLLTSDEEGDAIDGVRHVARLFAERGQRIDWCITGEPSSTATLGDLLRVGRRGSLSA
KLRVQGVQGHVAYPEKARNPIHQAAPALAELSARHWDDGYESFPPTSLQVSNIHAGTGAN
NVIPGELEVDFNIRYNPHWDAPKLEAEITALLERHGLQYTLKWHRSGEPFYTPEGTLRAT
ARAVLAEHIGRAPEESTGGGTSDARFIAPLGAQCIEVGPVNASIHQVDENVRVADLEALP
GLYQRLVERLLA
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgacctgacctgcgagctgatcgcgcggccctcggtgacgcccgatgatgccggt
tgccaggcgctgctggcggcacgcctgaagcaggccgggttccagtgcgatcacctgcgg
ctgggtgaggtcgacaacctgtgggcgacccacggccagggcgcgccggtactggtgctg
ctgggccataccgacgtggtgccgacgggcccgcgtgaggcctgggccagcgatccgttc
agcccgcagatccgcgatggcgtgctgtatggccgtggcgccgccgacatgaagggcagc
gtggcggcgttcgtggtggccgccgagcagttcgttgccgcgcatcctgatcatcacggc
acgctggcggtgctgctgaccagcgacgaggaaggcgacgccatcgatggcgtgcgccac
gtcgcacgcctgttcgccgaacgcggccagcgcatcgactggtgcatcaccggcgagccg
tcctcgactgcgacgctgggtgacctgctgcgcgtggggcgtcgcggcagcctgtcggcc
aagctgcgcgtgcagggcgtgcagggccacgtggcgtatccggagaaggcacgcaacccg
atccaccaggcggcgccggccctggccgagctgagtgcgcggcactgggatgacggctac
gaaagtttcccgccgaccagcctgcaggtctccaacatccatgccggtaccggtgccaac
aacgtgattcccggcgagctcgaggtggatttcaacatccgctacaacccgcactgggac
gcaccgaagctggaagcggagatcaccgcgctgctggaacggcatggcctgcagtacacg
ctgaagtggcaccgcagcggcgagccgttctacaccccggagggcacgctgcgcgccacc
gcgcgtgcggtgctggccgagcacatcggccgtgcaccggaagaaagcaccggcggcggc
acctccgatgcacgcttcatcgcgcccttgggcgcgcagtgcatcgaagtggggccggtc
aacgccagcatccaccaggtggacgagaacgtgcgcgtggccgatctggaggcattgccg
gggctgtaccagcggctggtggagcggctgctggcgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system