KEGG   Stenotrophomonas maltophilia D457: SMD_1352Help
Entry
SMD_1352          CDS       T02061                                 

Gene name
asnB
Definition
asparagine synthetase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
smz  Stenotrophomonas maltophilia D457
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:smz00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1512724..1514415
Genome map
AA seq 563 aa AA seqDB search
MCSIFGIFGLQAGDDLPALRRHALELSQRQRHRGPDWSGVYLDEGALLVHERLAIVDPAG
GSQPLLSADGQLALAVNGEIYNHQALKAALTTTYDFQTGSDCEVINALYRQGGAPAQWLE
QLNGIFAFALWDRDSGRVLVARDPVGVVPLYWGHDAQGRLRVASEMKALVDTCADVAQFP
PGHYFDSASGELVRYYQQPWRDYADVQGRQADLAELRQAFEHAVERQLMSDVPYGVLLSG
GLDSSLVAAVAARYARRRIEDGGQTEAWWPRLHSFAIGLKGSPDLAAAAIAAEALGTVHH
GFEYTFEEGLDALPEVIRHIETYDVTTIRASTPMFLLARRIKAMGVKMVLSGEGSDEIFG
GYLYFHKAPDAREFHDELVRKLDALHNYDCLRANKSMMAWGVEPRVPFLDREFLDVAMRF
DAAHKMVGAGFGGRRIEKAVLREAFDGYLPDSILWRQKEQFSDGVGYGWIDGLKAHAEAQ
VSDRVLAAADKRFPHNPPQTKEAYYYRHLFEQFFPSRAAAETVPGGKSIACSSPAAIAWD
ASFAAAADPSGRAIAGVHEQALA
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgtgttcgatcttcggaatcttcggcctgcaggccggtgacgatcttcccgccctgcgc
cggcacgcgctggaactgtcgcaacgccagcgccaccgtggcccggactggagcggcgtg
tacctcgacgaaggtgcgctgctggtccatgaacggctggccatcgtcgatccggccggt
ggttcgcagccgctgctgtcggccgatggccagctggcgctggcggtgaacggcgagatc
tacaaccaccaggcgttgaaggcggcgctgaccaccacctacgacttccagaccggctcg
gactgcgaggtgatcaacgcgctctaccgccagggcggcgcgccggcgcagtggctggaa
cagctcaacggcatcttcgccttcgcgctgtgggaccgtgacagtggacgcgtgctggtg
gcgcgcgacccggtgggcgtggtgccgctgtactggggccacgatgcccaggggcgcttg
cgcgtggcctcggaaatgaaggcgctggtcgatacctgtgccgatgtcgcgcagttcccg
ccgggccactatttcgacagtgccagcggtgagctggtgcgctactaccagcaaccgtgg
cgcgactacgccgacgtgcagggccgccaggccgatctggctgaactgcgccaggcgttc
gagcatgcggtggagcgccagctgatgagcgatgtgccttatggcgtgctgctgtccggt
ggcctggactcgtcgctggtggcggcggtggccgcgcgctatgcacgtcgtcgcatcgag
gatgggggacagaccgaagcctggtggccgcgcctgcactcgttcgcgatcggcttgaag
ggctcacccgatctggccgccgcagcgatcgccgccgaagcgctgggcaccgtgcatcac
ggtttcgagtacacgttcgaggaaggcctcgatgcgctgccggaggtgatccgccacatc
gagacctacgacgtcaccaccatccgcgcatcgacgccgatgttcctgctggcgcggcgg
atcaaggcgatgggcgtgaaaatggtgctctccggcgagggcagcgacgagatcttcggt
ggctacctgtacttccacaaggcaccggatgcgcgtgaattccacgacgagctggtacgc
aagctcgacgccctgcacaactacgactgcctgcgcgccaacaagtcgatgatggcctgg
ggcgtggagccgcgcgtgccgttcctcgaccgtgagttcctcgatgtggcaatgcgcttc
gatgccgcacacaagatggtcggtgccggttttggcggccgccgtatcgagaaggccgtg
ttgcgcgaggcgttcgacggctacctgccggacagcatcctgtggcggcagaaggaacag
ttcagcgatggcgtgggctatggctggatcgatgggctgaaggcacatgccgaggcgcag
gtgagcgaccgtgtactggcggccgccgacaagcgcttcccgcacaacccgccgcagacc
aaggaggcgtactactaccgccacctgttcgagcagttcttcccgagccgggcagcggcc
gagaccgtgccgggaggcaagtcgatcgcctgttcgtcgcccgcggccatcgcctgggac
gccagcttcgccgcggcggcagatccctccggtcgcgcgatcgccggcgtgcacgagcag
gcactggcctaa

DBGET integrated database retrieval system