KEGG   Stenotrophomonas maltophilia D457: SMD_1662Help
Entry
SMD_1662          CDS       T02061                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
smz  Stenotrophomonas maltophilia D457
Brite
Enzymes [BR:smz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     SMD_1662 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1833769..1834446
Genome map
AA seq 225 aa AA seqDB search
MSPRLRLQPEAVGIGMTSQRVRDRLVDRLREAGIVDEPTLNAIRVVPRHLFIDEALASRA
YEDTALPIGHGQTISQPWVVARMTEAVLQVSPKRVLEVGTGSGYQAAILGALGLEVYTVE
RIGDLLRQARKRFRALGMNIRTKHDDGRVGWAEHGPFDAIVVTAAAPALVDALIEQLAEG
GRLVAPVGGPGAQSLVQLDRKADGSIEQHVLAPVTFVPLLSGMLD
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgagcccacgcctgcgattgcagccggaagccgtcggtatcggcatgacctcgcagcgc
gtgcgtgaccgcctggtcgaccgcctgcgcgaagccggcatcgtcgacgagccgaccttg
aacgcgatccgggtggtgccgcgccatctgttcatcgatgaagccctggcctcgcgtgcc
tatgaagacaccgcgctgccgatcggccatggccagaccatctcgcagccctgggtggtt
gcgcggatgaccgaggcagtgctgcaggtctcgccgaagcgggtgctggaagtcggcacc
ggttccggttaccaggccgccatccttggcgcgttgggcctggaggtctacaccgtggag
cgcattggtgatctgctgcgccaggcccgcaagcgcttccgtgcgctgggcatgaacatc
cgcaccaagcacgacgacggccgcgtcggctgggccgagcacggcccgttcgatgccatc
gtggtcactgcggcggcgccggcactggtcgacgccctgatcgagcagctggccgaaggc
ggccgcctggtggcgccggtcggtggccctggggcgcagtcgctggtacagctggaccgc
aaggccgacggcagcatcgaacaacacgtgctggcgccggtcacgttcgtgccgctgctg
tctggcatgctcgactaa

DBGET integrated database retrieval system