KEGG   Stenotrophomonas maltophilia D457: SMD_1671Help
Entry
SMD_1671          CDS       T02061                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
smz  Stenotrophomonas maltophilia D457
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:smz00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1840865..1841761
Genome map
AA seq 298 aa AA seqDB search
MFDTSPQLDCAGRILRLDRARVMGIVNVTPDSFSDGGAHDTTEAAVAHGLKLVEEGADLL
DIGGESTRPGAAPVSVEEELRRVIPVIEQLAARTRVPISIDTFKPEVMRAAVAAGAGMIN
DIFALRQGGALEAAAETGVPVVLMHMQGEPGHMQADPHYDDVVAEVHGFLVQRLFAAEMA
GIAKKNLLIDLGFGFGKSTAHNMTLLARSERFLELGVPVLAGLSRKRSLGELTGRDTPSE
RVAASVAAHLIAVQRGARIVRVHDVAATVDALKIWQAVEAVPTPRADAAPMIRWPDED
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgttcgatacctcgccccagctcgattgcgccggccgcatcctgcgcctcgaccgtgcc
cgggtcatgggcatcgtcaacgtcaccccggactccttctccgatggcggcgcgcatgac
accaccgaggctgcggtcgcccatggcctgaagctggtcgaggagggcgccgacctgctc
gatatcggcggcgaatcgacccgcccgggcgctgcgccggtctcggtcgaggaggaactg
cgccgggtgattccggtgatcgagcagctggccgcccgcacccgggtgccgatcagcatc
gataccttcaagccggaggtgatgcgcgcggcggtggccgctggcgccggcatgatcaac
gacatcttcgccctgcgccagggcggtgcgcttgaagctgccgccgaaaccggcgtgccg
gtggtgctgatgcacatgcagggcgagccgggccacatgcaggccgatccgcactacgac
gacgtggtcgccgaggtgcatggtttcctggtgcagcgcctgttcgctgccgagatggcg
ggcatcgcgaagaagaacctgctgatcgaccttggttttggcttcggcaagagcaccgcc
cacaacatgaccctgctggcgcgttcggagcgcttcctggaactgggggtgccggtgctg
gccggcctgtcacgcaagcgcagcttgggagaactcactggccgcgacacgccctccgaa
cgcgtggcggcttcggtggccgcgcacctgatcgcggtccagcgtggcgcgcgcatcgtg
cgcgtgcatgacgtggcggccaccgtcgatgcgctgaagatctggcaggcagtggaggcc
gtgccgacgccgcgtgccgacgctgcgccgatgatccgctggccggacgaagactga

DBGET integrated database retrieval system