KEGG   Stenotrophomonas maltophilia D457: SMD_1689Help
Entry
SMD_1689          CDS       T02061                                 

Gene name
phoD
Definition
phosphodiesterase/alkaline phosphatase D (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
smz  Stenotrophomonas maltophilia D457
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:smz00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:smz00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:smz02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1863474..1865069
Genome map
AA seq 531 aa AA seqDB search
METINRRRFLALAGLSAAGAWMGTARALAAQADATTLNPRNLLAKPRFASTPFTLGVASG
DPTADGMVLWTRLATEPLVFGGGMPTRPMVVEWQLAADEGMRKVVRQGSALAHPELGHAV
HVELEGLAPGRPYWYRFTVGGHASAVGCTRTLPAAAAAVDRVRFVVAGCQHYEEGHYTAW
RRIAEEPLDFVFHYGDYIYEGESQPGLRKMNGQPFTNLRNHVGPQTYTLDDYRRRYAQYK
SDADLQAAHASAPWFVTFDDHEVDNNWAGAEDQDDTPSEVFLLRRAQAFQAYYENMPLRR
SAFPRDGHMQLYRRARYGTLMDLHLLDTRQYRSKQVNMALREDVESPERSIVGAKQERWL
FDGLADAAPRWHTIAHQVALGNYMREKDGVVQSSDDQWSGYLDSRRRLLDHIQKVGFGNV
VTACGDAHRHYASDLVQDHRDSGVVSSEFLATSITSGADGQGVDAYARNQLAHSPNLKAT
TDKRGYLLCDVTHDAWIGDMKTLDTVMRPNGTVQSWKRYAVEHGRPGLQEA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
gtggagacgatcaatcgcaggcgattcctggccctggccggcctgtccgctgccggcgcc
tggatgggcacggcacgcgcgctggccgcgcaggccgatgccaccacgctgaacccgcgc
aacctgctggccaagccgcgctttgccagcacgcccttcaccctgggcgtggcctcgggt
gatcccacggccgacggcatggtgctgtggacgcggctggcgacggagccgctggtgttc
ggcggtggcatgccgacccggccgatggtggtcgaatggcagctggcagcggacgaaggc
atgcgcaaggtggtacgccagggttcggcgctcgcgcatcccgaactcggccacgcggtg
cacgtggaactggaaggattggcgcccggacggccctactggtaccgctttaccgtgggt
ggccacgccagtgcagtcggttgtacccgcacgctgccggcagccgcggcagcggtggat
cgcgtgcgctttgtggtggccggctgccagcactacgaagaaggccactacaccgcgtgg
cggcgcatcgccgaggaaccgctggatttcgtcttccactacggtgattacatctacgaa
ggtgaaagccagcctggcctgcggaagatgaacggccagccgttcaccaacctgcgcaac
cacgtcggcccgcagacctacacgctggatgattaccgccgccgctatgcccagtacaag
agcgatgccgacctgcaggccgcgcatgcgtcggcaccgtggttcgtcactttcgatgac
catgaagtggacaacaactgggccggcgccgaagaccaggacgatacgcccagcgaagtg
ttcctgctgcggcgcgcacaggcgttccaggcctactacgagaacatgccgctgcgccgt
tcggcattcccgcgcgatggccacatgcagctgtaccggcgcgcacgctacggaacgctg
atggacctgcacctgctcgacacacgccagtaccgcagcaagcaggtgaacatggcgctg
cgtgaggacgtggaatcgccggagcgcagcatcgtcggtgcgaagcaggagcgctggctg
ttcgatggcctggccgatgccgcaccgcgttggcacaccatcgcccaccaggtagcgctg
ggcaactacatgcgcgagaaggacggcgtggtgcagtcgtccgatgaccaatggtcgggt
tacctggacagccgtcggcgcctgctcgaccacatccagaaggtcggcttcggcaacgtg
gtgaccgcctgtggcgacgcgcaccggcattacgccagcgacctggtgcaggaccatcgt
gattcgggcgtggtctccagcgagttccttgccacttcgatcacttccggtgctgacggc
cagggcgtggacgcgtatgccaggaaccagcttgcgcacagccccaatctgaaggcgacc
accgacaagcgtggctacctgctgtgcgatgtcacccatgatgcgtggatcggcgacatg
aagacgctggatacggtgatgcgaccgaacggtaccgtgcagagctggaagcgctacgcg
gtggagcacggccggccggggctgcaggaggcctga

DBGET integrated database retrieval system