KEGG   Stenotrophomonas maltophilia D457: SMD_1733Help
Entry
SMD_1733          CDS       T02061                                 

Gene name
sdhD
Definition
(GenBank) Succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
smz  Stenotrophomonas maltophilia D457
Pathway
smz00020  Citrate cycle (TCA cycle)
smz00190  Oxidative phosphorylation
smz00650  Butanoate metabolism
smz01100  Metabolic pathways
smz01110  Biosynthesis of secondary metabolites
smz01120  Microbial metabolism in diverse environments
smz01130  Biosynthesis of antibiotics
smz01200  Carbon metabolism
Module
smz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
smz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
smz_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:smz00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SMD_1733 (sdhD)
   00650 Butanoate metabolism
    SMD_1733 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    SMD_1733 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: CCH12279
Position
1908200..1908586
Genome map
AA seq 128 aa AA seqDB search
MSKFRTPLKNVRGLGSAKTGTEHFVHQRLTAAALVVLGIWFLVFVLGLLGSDYATAAAAV
AKPWNAVPLIGLLIAMFWHAQLGMQVVLEDYIHESLLALVLQTAVKFVAVLGMIVSVFAV
GRIALGVA
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaagttccgtaccccgttgaagaacgtgcgcggccttggctcggccaagaccggc
accgagcacttcgtgcaccagcgcctgaccgccgccgcactggtggtgctgggcatctgg
ttcctggtcttcgtgctgggcctgctgggctcggactacgccaccgccgccgccgccgtg
gccaagccgtggaacgcggtgccgctgatcggcctgctgatcgccatgttctggcacgcg
cagctcggcatgcaggtcgtgctggaagactacatccacgaatcgctgctggccctggtg
ctgcagaccgcggtgaagttcgtcgccgtgctcggcatgatcgtcagtgtgtttgcggtg
ggccgcatcgccctcggcgttgcctga

DBGET integrated database retrieval system