KEGG   Stenotrophomonas maltophilia D457: SMD_1845Help
Entry
SMD_1845          CDS       T02061                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
smz  Stenotrophomonas maltophilia D457
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smz00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SMD_1845 (galU)
   00052 Galactose metabolism
    SMD_1845 (galU)
   00500 Starch and sucrose metabolism
    SMD_1845 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    SMD_1845 (galU)
Enzymes [BR:smz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SMD_1845 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2038733..2039536
Genome map
AA seq 267 aa AA seqDB search
MPKEMLPIIDRPLIQYAVDEAIEAGCDTLVFITNRYKHAVADYFDKAYELEQKLERAGKQ
EQLELIRHVLPNGVRAIFVTQAEALGLGHAVLCARSVIGDEPFAVLLPDDLIWNRGAGAL
KQMADLNEASGASVIAVEDVPHDKTASYGIVATDAFDGRKGRISQIVEKPKPEDAPSDLA
VVGRYVLSPKIFELLEQTQTGAGGEIQLTDAIAELLKTEEVDAYRFEGTRFDCGTHLGLV
EATIRFALDNPKLAGPAREKLAAMLAE
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtgccgaaggagatgctgccgatcattgatcggccgctgatccagtacgcggtggatgag
gcgatcgaagccggctgtgacacgctggtgttcatcaccaaccgctacaagcacgccgtt
gccgactatttcgacaaggcgtacgagctggagcagaagcttgagcgcgctggcaagcag
gagcagctggaactgatccggcacgtgctccccaatggtgtgcgcgcgatcttcgtgacc
caggccgaggcgctgggcctcgggcacgcggtgctgtgtgccaggtcggtgatcggtgac
gagccgtttgccgtactgctgcccgacgacctgatctggaaccgcggtgcgggcgcgctg
aagcagatggccgacctcaacgaagccagtggcgccagcgtgatcgcggtcgaagacgtg
ccgcacgataagaccgccagttacggcatcgtcgccaccgacgcgttcgatggccgcaag
ggccgtatttcgcagatcgtcgagaagccgaagccggaggacgcgccgagcgacttggcg
gtggtgggccgttacgtgctcagcccgaagatcttcgagctgctggaacagacccagacc
ggtgccggcggcgagatccagctgaccgatgcgattgccgagctgctgaagaccgaagaa
gtcgatgcctatcgtttcgagggcacccgcttcgactgcggcacgcacctgggtctggtg
gaggcgacgatccgcttcgcgctggacaacccgaagctggctggcccggcgcgggagaag
ctggcggcgatgctggcggaataa

DBGET integrated database retrieval system