KEGG   Stenotrophomonas maltophilia D457: SMD_1928Help
Entry
SMD_1928          CDS       T02061                                 

Definition
protein-glutamate methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
smz  Stenotrophomonas maltophilia D457
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:smz00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SMD_1928
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    SMD_1928
Enzymes [BR:smz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     SMD_1928
Two-component system [BR:smz02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   SMD_1928
Bacterial motility proteins [BR:smz02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    SMD_1928
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2132275..2132850
Genome map
AA seq 191 aa AA seqDB search
MSLLIRPAVLVIGASAGGVAALQTVLGALPAALPAPVLAVLHLPRDRSSRIAEVLAPYCA
LPVREAEDKQPLQPGTVTFAPPDYHLLVEDAGSLALSVDAPVLFSRPAIDPLFESAAAVF
GAQVLALLLTGASSDGSEGVAAVRAAGGRAWLQCPEEAEASMMPASALQHAGADAVLPLE
LMCRRLKELFA
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgctgatacgaccggccgtgctggtgatcggggcctctgcgggtggggtcgca
gcgctgcagacggtgcttggcgcgctgcctgcggcactgccggcgccggtgctggcagtg
ctgcacctgccacgcgatcgcagcagccgcatcgccgaagtgctggcgccgtactgcgcg
ctgccggtgcgcgaggccgaagacaagcagccgctgcagcctggcacggtgacctttgcg
ccaccggactatcacctgctggtggaagacgccggttcgctggcgctgtcggtggacgca
ccggtgctgttttctcgcccggccatcgatccgctgttcgagtcggcggcggcggtgttc
ggcgcgcaggtgctggccctgctgctgaccggtgccagcagtgatggcagcgaaggcgtg
gccgccgtgcgcgccgctggtggccgcgcctggctgcaatgtcccgaggaggccgaggca
tcgatgatgccggcctccgccctgcagcacgctggcgccgatgccgtgctgccccttgaa
ctgatgtgccgtcgcctgaaggagttgtttgcatga

DBGET integrated database retrieval system