KEGG   Stenotrophomonas maltophilia D457: SMD_1941Help
Entry
SMD_1941          CDS       T02061                                 

Gene name
thrC
Definition
Threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
smz  Stenotrophomonas maltophilia D457
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:smz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SMD_1941 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SMD_1941 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SMD_1941 (thrC)
Enzymes [BR:smz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SMD_1941 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2143396..2144682
Genome map
AA seq 428 aa AA seqDB search
MQFVSTRGQSPAVGLSAAIAAGLAPDGGLYVPARLPAARELQAGATLADTAADLLAPLFA
GDALETALPAICREAFDFPVPLRALGEGDHVLELFHGPTAAFKDIGARFLAGTLSRLQGG
EDRDLTIVVATSGDTGAAVAAAFHRQPGVRVVVLYPEGRVSPRQAHQLGCFGDNIQALRV
TGAFDDCQAMVKQALADRELQAQVPVSSANSISLGRLLPQMSYYAHAALTHYAAHRRRLN
LVVPTGNLGNAMAAVLARALGVPIGQIVLATNANAVLPAYFNGGDYQPQASVATVANAMD
VGAPSNFERLRWLYHGDDAELRAAFRAFAVDDVTIRATIAAAHASGGEQFCPHTATAVKV
LQDLRARGAKGDWAAVATAHPAKFEAVVEPLIGETVAVPPALDALLQRPAHAEPLAADYA
ALREVLLR
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgcaatttgtttcgacccgcggccagtctcccgccgttggcctcagcgcggcgatcgcc
gccggattggcgcccgatggcgggctgtatgttcccgcgcgtctgccggccgcgcgcgag
ctgcaggccggggcgaccctggccgataccgccgccgatctgctggcaccgttgtttgcg
ggcgatgcactcgagactgcgcttccggcgatctgccgcgaagcgttcgacttcccggtg
ccgctgcgtgcactcggcgagggtgaccacgtgctggagctgttccatgggccgacggcg
gcattcaaggatatcggcgcgcgcttcctggccggtacgctgtcgcgcctgcagggcggc
gaggatcgcgatctgacgatcgtcgtcgccacgtccggcgatacgggtgccgccgttgcg
gcggccttccatcgccagccgggcgtgcgcgtggtggtgctgtatccggagggtcgcgtg
tctccgcgccaggcgcatcagctcggttgtttcggcgacaacatccaggccctgcgcgtg
acgggcgcattcgacgattgccaggcgatggtcaagcaggcgctggccgaccgcgaactg
caggcgcaggtgccggtgagctcggccaacagcatcagcctgggccgactgctgccgcag
atgagctactacgcgcatgcagcgttgacccactacgccgcgcatcgtcgccggctcaac
ctggtggtgccgaccggcaatctgggcaacgcgatggcggccgtgctggcgcgcgcgctg
ggcgtgccgatcggccagatcgtgctggccaccaatgccaatgccgtgctgccggcgtac
ttcaatggtggcgactaccagccgcaggccagtgtggcgacggtggccaatgcaatggac
gtgggtgcgccgagcaacttcgagcgactgcgctggctctaccacggcgacgacgcagag
ctgcgtgcagctttccgcgcgttcgcggtggatgacgtgaccatccgcgcgacgattgcc
gcagcgcatgccagcggcggcgagcagttctgcccgcacacggcgacggcggtgaaggtg
ctgcaggatctgcgcgcgcgcggtgccaagggcgactgggcggcggtggctacggcgcat
ccagccaagttcgaggctgtggtcgagccgctgatcggcgaaacggtggcggtgccacct
gcgctggatgccttgctgcagcgaccagcgcacgccgaaccattggcggcagattacgcg
gccttgcgcgaggtgttgctgcgttga

DBGET integrated database retrieval system