KEGG   Stenotrophomonas maltophilia D457: SMD_1956Help
Entry
SMD_1956          CDS       T02061                                 

Definition
(GenBank) predicted N-acetylglucosamine kinase,glucokinase-like
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
smz  Stenotrophomonas maltophilia D457
Pathway
smz00010  Glycolysis / Gluconeogenesis
smz00052  Galactose metabolism
smz00500  Starch and sucrose metabolism
smz00520  Amino sugar and nucleotide sugar metabolism
smz00521  Streptomycin biosynthesis
smz01100  Metabolic pathways
smz01110  Biosynthesis of secondary metabolites
smz01120  Microbial metabolism in diverse environments
smz01130  Biosynthesis of antibiotics
smz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:smz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMD_1956
   00052 Galactose metabolism
    SMD_1956
   00500 Starch and sucrose metabolism
    SMD_1956
   00520 Amino sugar and nucleotide sugar metabolism
    SMD_1956
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SMD_1956
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SMD_1956
Enzymes [BR:smz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SMD_1956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: CCH12499
Position
2157066..2158088
Genome map
AA seq 340 aa AA seqDB search
MTIAAASTVSSDSARGGLPRRLVVADVGGTFARLALAETRPGQTPLLGSHRTYACAEHSS
LAAILADFTAGLGHPVQTAVVAIAGLLDGDVLINSNLPWTVSLSATRAQSGLHELQLIND
FEAVALAIPYLQPETLVPLNGDADPAQAFPALVLGAGTGLGAALRFADGERPVLASEIGH
AALGAGNALELQVLGRLLQRWPHVDNERVLSGSGLMNLYPCLCELRGVTPVWNSTEALIG
AARGGEDALAVETLQVFCAWLGSLAGDAAIAVGARSVYLAGGISAHVQDFLADGRFRERF
LNKGVLTEVLRQVPVWRVEHGQLGVLGAAVWHAARQPTHD
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgaccatcgcagcagcgtcaacggtttcctccgactccgcccgcggcggtcttccgcgc
cgtctggtcgtcgccgatgtcggcggcacctttgcccggctcgcgctggcggaaacccga
cccggccagacgccgctgctgggcagccaccgtacctatgcctgtgccgagcattccagc
ctggccgcgatcctcgccgatttcaccgccggcctcggccacccggtgcagaccgcggtg
gtcgccatcgctggcctgctggatggcgatgtgctgatcaactcgaacctgccgtggacg
gtctcgctgtcggccacccgcgcgcagtccgggctgcacgaactgcagctgatcaatgat
ttcgaagcggtggcgctggccatcccctacctgcagccggaaaccctggtgccactgaac
ggcgacgccgatccggcgcaggccttcccggcgctggtgctgggcgcgggtaccgggctg
ggcgccgcgctgcgtttcgctgatggcgagcgtccggtgctggccagcgagatcggtcat
gccgcgctgggcgccggcaacgcgctggaactgcaggtgctgggccgcctgctgcagcgt
tggccgcacgtggacaacgaacgcgtgctgtccggcagcggcctgatgaacctgtatccg
tgcctgtgcgaactgcgcggcgtcaccccggtgtggaacagtacggaggcgctgatcggc
gccgcgcgtggcggtgaggatgcactggcggtggaaacgttgcaggtcttctgtgcgtgg
cttggcagcctggccggcgacgcggcgatcgccgtcggcgcgcgctcggtgtacctggcc
ggtggcatttccgcgcatgtgcaggatttcctggccgatggccgcttccgtgagcgcttc
ctcaacaagggcgtgctgaccgaggtgctgcgccaggtgccggtgtggcgcgtggagcat
ggccagctgggcgtgcttggcgcagcggtctggcacgccgcacggcagcccacgcacgac
tga

DBGET integrated database retrieval system