KEGG   Stenotrophomonas maltophilia D457: SMD_2239Help
Entry
SMD_2239          CDS       T02061                                 

Gene name
xylA
Definition
Xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
smz  Stenotrophomonas maltophilia D457
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:smz00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:smz00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2496708..2498042)
Genome map
AA seq 444 aa AA seqDB search
MSTQPFIGAKEYFPGVGRIPFEGKGSDNPLAFKVYDANRVIGGKTMQEHLRFAVCYWHTF
CNAGHDPFGPGTRQFPWEAASPLATAEAKVDAAFEFFTKLGVPYWCFHDIDLAPDADDIG
QYQKNLSHMVALAKARQEATGVRLLWGTANLFSHPRYMNGASTNPDFAVVARAAVQVKAA
LEATVELGGEHYVFWGGREGYASLANTQMKREIEHFARFLTMARDYGRSIGLKGNFLIEP
KPMEPMKHQYDFDSATVVGFLKEHGLDKDFKLNIEANHATLSGHTFEHDLQVASDHGLLG
SIDANRGNAQNGWDTDQFPSDLYDTVGAMLVVLRQGGLEGGLNFDAKVRRESTDLEDLFI
AHIGGMDAFARGLEVAHALLTESPWEQWRKERYASFDSGAGQEFERGALSLPDLAGLAAR
LGEPHQASGKQERYENLLNQYLLR
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcagcccttcatcggcgccaaggagtacttccccggcgtcggccgcattccg
ttcgagggcaagggctcggacaatccgcttgccttcaaggtctacgatgcaaaccgggtc
atcggtggcaagaccatgcaggagcatctgcgcttcgccgtgtgctactggcacaccttc
tgcaatgccgggcacgatccgttcggcccgggtacccggcagttcccgtgggaggcagcc
tcgccactggccacggccgaagcgaaggtggacgcggcgttcgagttcttcaccaagctg
ggcgtgccgtactggtgcttccacgatatcgacctggcgccggatgccgacgacatcggc
cagtaccagaagaacctctcgcacatggtggccctggccaaggcgcgccaggaggccacc
ggcgtcaggctgctgtggggcacggccaacctgttctcgcacccgcgttacatgaacggc
gcatcgaccaaccccgacttcgcggtggtcgcgcgcgcagcggtgcaggtcaaggccgcg
ctggaggccacggtcgaactcggcggcgagcactacgtgttctggggcggacgcgaaggt
tatgcgtcgctggccaatacccagatgaagcgcgagatcgaacatttcgcgcgcttcctc
accatggcccgcgactacggccgcagcatcggcctgaagggcaacttcctgatcgagccc
aagccgatggagccgatgaagcaccagtatgacttcgacagtgccacggtggtgggcttc
ctgaaggagcatgggctggacaaggacttcaagctcaacatcgaagccaaccacgccacg
ttgtccgggcacaccttcgagcacgacctgcaggttgcgtccgaccatggcctgctcggc
agcatcgatgccaaccgcggcaacgcgcagaacggctgggacaccgaccagttccccagc
gatctgtacgacacggtgggtgcgatgctggtcgtgctgcgccagggcgggctggagggc
gggttgaacttcgatgccaaagtgcgccgtgagtcgaccgaccttgaggatctgttcatt
gcccatattggcggcatggatgcgttcgcacgcgggctggaggttgcccatgcactgctg
accgagtcgccctgggagcaatggcgcaaggagcgctacgcgagtttcgacagcggcgcc
ggccaggagttcgagcgtggcgcgctcagcctgccggacctggcgggcctggccgcccgc
ctcggcgaaccgcaccaggccagcggcaagcaggagcgttacgaaaacctgctcaaccag
tacctgctgcgctga

DBGET integrated database retrieval system