KEGG   Stenotrophomonas maltophilia D457: SMD_2427Help
Entry
SMD_2427          CDS       T02061                                 

Gene name
glgB
Definition
1,4-alpha-glucan (glycogen) branching enzyme,GH-13-type (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
smz  Stenotrophomonas maltophilia D457
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:smz00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2700936..2703170)
Genome map
AA seq 744 aa AA seqDB search
MSHDSLHLAALEDEAITETGLDQRIAPALQDLVHARPADAFAWLGPHRQPEGGRQLRVLV
PHAQRVEVIADDGRRWNLSPGPLPGLFEGAAGDAAIPLLALHFEQGVEQVHDAYAFGPLL
DEALLQRFHAGDADAARQLGAVPMQVQGIAGVRFAVWAPNAQRVAVVGDFNGWDGRRHPM
RLRHTAGVWELFLPGVQAGARYKFRIVGADGRVMPDKFDPMARWAELPPATASRVPSAGP
MEWHDDAWLAARRLAGTCAPLSIYEVHAGSWQRSDDGAPLDWDALADRLIPYVAGLGFTH
IELLPVSEHPFGGSWGYQPLGIYAPTARHGTPQAFARFVDRCHQAGVGVIVDWVSAHFPN
DAHGLAGFDGTALYEHADPREGVHADWDTLIYNYGRNEVAAYLIGSALEWVERFHVDGLR
VDAVASMLYRDYSRAEGEWVPNEQGGRENLQAVAFLRRMNQTLRERFPDVLVIAEESTAW
PGVTAPVEEGGLGFTHKWNMGWMHDTLQYLGRDPVHRSHHHSQISFGLVYAFSERFVLPL
SHDEVVHGKGALLAKMAGEPAQRLAQLRAYYGFMWAHPGSKLLFMGGEFGQGHEWSHDAA
LDWARAASNEGQGLSRLVGDLNNVLRAEPALHRDERDERGFDWSVADDSRNSVYAFIRRD
PAGSGRTLLVVSNFTPLRRDGYRVGVPQPGRWSERLNTDSAYYGGSNAGNLGAVHTEPRP
MHGHAQSLRLTLPPLSTLYLQVDA
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgagccacgacagcctgcatctggccgccctggaggatgaagcgatcacggagacggga
ttggatcagcgtatcgccccggcgctgcaggacctcgtccacgcgcgcccggccgatgca
ttcgcctggctgggcccgcatcgccagccagaaggcggacgccagctgcgcgtgctggtg
ccgcatgcgcagcgcgtcgaggtgattgcagacgatgggcggcgctggaacctgtcccct
ggcccgttgcccggcctgttcgagggcgcggccggtgacgcggcgataccgctgcttgcc
ctgcatttcgaacagggcgtggagcaggtgcacgatgcctatgcgttcggtccactgttg
gacgaagccctgctgcagcggttccatgccggtgatgccgatgcggcgcggcagctgggt
gcggtgccgatgcaggtgcagggcattgcgggcgtgcgcttcgcggtgtgggcgcccaat
gcccagcgggtcgccgtggttggcgatttcaacgggtgggacggccgacgccatccgatg
cggctgcgtcacaccgccggcgtgtgggagctgttcctgccgggcgtgcaggccggtgcc
cgctacaaattccgcatcgtcggcgccgacggccgggtgatgcccgacaagttcgatccg
atggcgcgctgggccgagctgccaccggcgaccgcatcgcgggtgccttcggctgggcca
atggagtggcacgatgatgcttggttggcggcccgccgcctggccggaacctgcgcgccg
ctgtcgatctacgaagtgcatgccggttcctggcagcgcagcgacgatggtgcgccgctg
gactgggatgccctggccgaccgtttgattccgtacgtggccggtcttggcttcacccat
atcgagctgttgccggtgagcgagcatcccttcggcggttcctggggctatcagccgctg
gggatctacgcgccgacggcacgccatggcacgccacaggccttcgcacgcttcgtggac
cgctgtcaccaggccggcgtgggagtgatcgtggactgggtgagcgcgcacttccccaac
gatgcgcatggcctggccgggttcgatggcaccgcgctgtacgagcatgccgacccgcgc
gaaggggtgcacgccgactgggacacgctgatctacaactacggccgcaacgaagtggcc
gcctacctgatcggcagtgcgttggagtgggtggagcgcttccatgtcgacggtctgcgc
gtggacgccgtagcgtcgatgctgtaccgggattacagccgtgccgagggggagtgggta
cccaacgagcagggcgggcgcgagaacctgcaggcggtcgctttcctgcggcggatgaac
cagacgctgcgggagcgcttcccggacgtgctggtgatcgccgaggaatccaccgcgtgg
ccgggggtgacagcgccggtggaggagggcgggcttggcttcacccacaagtggaacatg
ggctggatgcacgacaccctgcagtacctgggccgcgatccggtccatcgttcgcatcac
cacagccagatcagcttcggcctggtctacgccttctccgaacggttcgtgctgccgctg
tcccacgacgaggtggtgcatggcaagggcgcgctgctggccaagatggcgggcgagccg
gcacagcggctggcccagctgcgcgcgtattacggcttcatgtgggcgcacccgggcagc
aaactgctgttcatgggcggcgagttcggccagggccatgagtggtcgcacgatgcggca
ctggactgggcacgggcggccagcaacgagggccagggcctgtcgcgcctggtgggcgac
ctcaataacgtgctccgcgccgaacctgcgttgcatcgcgacgaacgcgacgaacgcggc
ttcgactggagcgtggcggacgacagtcgcaacagcgtctacgccttcatccgccgggat
cctgccggcagcggccgcaccctgctggtggtgagcaacttcaccccgctgcgtcgcgac
ggctaccgggtcggggtgccgcaaccggggcgctggagcgaacggctcaacaccgacagc
gcgtattacggtggcagcaatgcgggaaacctcggcgcagtgcataccgagccgaggccg
atgcacggccacgcgcagtcgctgcggctcacgctgccgccgctgtccacgctctacctg
caggttgatgcatga

DBGET integrated database retrieval system