KEGG   Stenotrophomonas maltophilia D457: SMD_2866Help
Entry
SMD_2866          CDS       T02061                                 

Gene name
proB
Definition
(GenBank) Glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
smz  Stenotrophomonas maltophilia D457
Pathway
smz00330  Arginine and proline metabolism
smz00332  Carbapenem biosynthesis
smz01100  Metabolic pathways
smz01130  Biosynthesis of antibiotics
smz01230  Biosynthesis of amino acids
Module
smz_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:smz00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SMD_2866 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    SMD_2866 (proB)
Enzymes [BR:smz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SMD_2866 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: CCH13394
Position
complement(3187848..3189005)
Genome map
AA seq 385 aa AA seqDB search
MTLHAATVASPFPQQALPPWRRAVLKVGSSLLAADGGGLSPRHALGLAQFVSANVLAGRE
VVIVSSGAVAAGRAILPRADEPGAAMAARQALAALGQAQLIGLWQRFFERPVAQVLLTHD
DLRNRRRYLNARATLSELLRLGALPVVNENDTVSVDELKLGDNDNLAATVAALVDADALF
IATDIDGLYSADPRTVADARPLHDVPELSDDVLAMAGGAGSRAGTGGMRTKLEAAAKAGR
LGIETYLFNGRSSDVVRALAQDRLFGTRIHAARSREAARKHWLRHAPLAEGAIVVDAGAA
QAMREKGASLLPGGITAAEGAFRRGDMVQVCWIAPQGRVCVARGVSQYAADDVRRIAGHH
SRDIQAVLGYNYGGSVVHRDDLVLP
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgcacgccgccaccgtcgcttcgccgttcccgcaacaggcgctgccgccatgg
cggcgtgcggtgctgaaggttggcagcagcctgctggcggccgatggtggcggcctgtcg
ccacgccacgcgctgggcctggcccagtttgtgtccgccaacgtactggctgggcgcgag
gtggtgatcgtctcctccggcgcggttgcggcggggcgcgcgatcctgccgcgggccgat
gaacccggtgcggcgatggcggcgcgccaggccctggccgcgctcggccaggcgcagctg
atcgggctctggcagcgcttcttcgagcgcccggtggcgcaggtgctgctgacccacgac
gacctgcgcaaccgccgccgctacctcaatgcacgcgccacgctgagcgaactgctgcgg
ctgggtgcgctgccggtggtcaacgagaacgacaccgtatcggtggacgagctcaagctc
ggtgacaacgacaacctggccgcgaccgtggccgcgctggtcgatgccgatgcactgttc
atcgccaccgacatcgacggcctgtacagcgcagatccgcgcaccgtggccgacgcgcgg
ccactgcacgacgtgccggaactgagtgacgatgtgctggcgatggccggcggcgccggc
tcgcgcgccggcaccggcggcatgcgtaccaagctggaggcggcggccaaggcgggccgc
ctcggcatcgagacctacctgttcaacggccgcagcagcgatgtggtgcgcgcgctggcg
caggaccgcctgttcggcacccgcatccacgccgcacgcagccgcgaggctgcccgcaag
cactggctgcggcacgcgccgctggccgagggcgcgatcgtcgtcgatgccggtgcggca
caggcgatgcgggagaagggcgcctcgctgctgcccggcggcatcaccgctgccgagggg
gcattccggcgcggcgacatggtgcaggtgtgctggatcgcacctcaggggcgtgtctgt
gtcgcccgcggcgtcagccagtacgcggccgacgacgtgcgccggatcgccggccatcat
tcgcgcgacatccaggccgtgctgggctacaactacggcggcagcgtcgtccatcgtgac
gacctggtgctgccatga

DBGET integrated database retrieval system