KEGG   Stenotrophomonas maltophilia D457: SMD_2992Help
Entry
SMD_2992          CDS       T02061                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
smz  Stenotrophomonas maltophilia D457
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:smz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SMD_2992 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SMD_2992 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SMD_2992 (trpB)
Enzymes [BR:smz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SMD_2992 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(3309580..3310797)
Genome map
AA seq 405 aa AA seqDB search
MSASPIADYHAFPDAQGHFGRYGGSFVAETLVGPLQELAQAYDQARQDPAFQAAYDRDLA
HYVGRPSPIYHAQRLSDHVGGAQILLKREDLNHTGAHKINNTIGQALLAARMGKKRIIAE
TGAGQHGVASATVAARLGLECVVYMGATDIERQKINVYRMKLLGATVVPVTSGSATLKDA
LNEAMRDWVTNVQDTFYIIGTVAGPDPYPRMVRDFNAIVGREAREQMLAEYGRLPDAITA
CVGGGSNAIGLFHAFLNDRQVEIVGAEAAGDGISTGRHAASIAAGRPGVLHGNRTYVLCD
DDGQIIETHSVSAGLDYPGVGPEHAFLADTGRARYLGITDEEALQAFHLLAHTEGILPAL
ESSHALAQAIKLARERPRDQIVLCNLSGRGDKDVHTIAAREGLVL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcctcccccattgccgactaccacgccttcccggatgcccagggccatttcggc
cgctacggtggcagcttcgttgccgaaaccctggtcggcccgctgcaggaactcgcccag
gcctatgaccaggcccgccaggatccggccttccaggccgcctacgaccgcgacctggcc
cactacgtgggccggccgagcccgatctaccacgcccagcggctgagcgaccatgtcggc
ggcgcgcagatcctgctcaagcgcgaagacctgaaccacaccggcgcgcacaagatcaac
aacaccatcggccaggcgctgctggcggcgcggatgggcaagaagcgcatcatcgccgag
accggtgccggccagcacggcgtggccagcgccacggttgccgcgcggctgggcctggaa
tgcgtggtgtacatgggcgccaccgacatcgagcggcagaagatcaacgtctaccgcatg
aagctgctcggcgcgacggtggtgccggtcacctccggttcggccaccttgaaggacgcg
ctcaacgaagcgatgcgcgactgggtgaccaatgtgcaggacaccttctacatcatcggt
acggtcgccggtccggatccctacccgcgcatggtgcgcgacttcaacgccatcgtcggc
cgcgaggcacgcgagcagatgctggccgagtacggccgcctgcccgatgcgatcactgcc
tgcgtcggcggcggcagcaatgccatcggcctgttccatgccttcctcaacgaccgccag
gtcgagatcgtcggcgccgaggccgcaggtgatggcatcagcaccggtcgccatgctgca
tcgatcgccgccggtcgcccgggcgtgctgcatggcaaccgcacctatgtactgtgcgac
gacgacggccagatcatcgagacccattcggtgtcggccggcctggactatccgggcgtc
ggccccgaacacgcattcctggccgataccggccgcgcgcgctacctcggcatcaccgat
gaagaagcactgcaggccttccacctgctggcgcataccgagggcatcctgccggcgctg
gagtccagccatgcgctggcgcaggcgatcaagctggcgcgtgagcgtccgcgtgaccag
atcgtgctgtgcaatctgtccggccgtggcgacaaggatgtgcataccatcgccgcgcgc
gaagggctggtgctgtga

DBGET integrated database retrieval system