KEGG   Stenotrophomonas maltophilia D457: SMD_3044Help
Entry
SMD_3044          CDS       T02061                                 

Gene name
phoA
Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
smz  Stenotrophomonas maltophilia D457
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:smz00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:smz00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:smz02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3379363..3381069
Genome map
AA seq 568 aa AA seqDB search
MRRSVSLLAACATTLLLGACASTTPASAPAGLKVAVDPVAHPAGETPQWWYRSGAAQAAA
NGAMSGKAKNVILFLGDGMSLTTVAASRIYEGQQKGGSGEENLLSWERFPATAFSKTYNT
DSQTPDSAGTMTAITTGVKTHMGAIGVSAGSRTDCADSLSKGLLTWLQLADSAGLATGVV
STARLTHATPAATYAHSPERNWENDTDLTEAAKAAGCKDIAQQLLSTSRYGRGPLVALGG
GRGEFTTVEERDPEYDDKVGQRLDGRSLVQEWQQAHPQGAYVWNSKQLAAAANAPAILGL
FEPDHMRYEYERPQDPGGEPSLAELTAAAIRNLARHQEGYVLMIEGARIDHANHSGNAYR
ALTETVALSDAVRVANELTSADDTLIIVTADHSHTLNFVGYPARGNPILGKVKDKGGEDG
AGKLDYALDGTGQPYTTLSYANGPGHTGSSNQQPAGPKRYPHNPSSFEPANGRPNLREVD
TEHPDYMQEALVPMKSESHGGEDVGIWARGPGSKAIRGTLEQNAIYHMIVQATPALRERL
CQAGTCDDKGVPVQLPAPTAFERKAEAK
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgttccgtctccctgttggccgcctgcgccaccaccctgctgctgggcgcctgc
gccagcaccacccccgcctctgccccggccggcctgaaggtcgccgtcgacccggtcgcc
catccggccggcgagaccccgcaatggtggtaccgcagtggcgccgcccaggccgccgcc
aacggcgcgatgtccggcaaggcgaagaacgtcatcctgttcctcggcgacggcatgagc
ctgaccaccgtggccgcctcgcgcatctacgaaggccagcagaagggtggctcgggcgag
gagaacctgctgtcctgggagcgcttcccggccacggcgttcagcaagacctacaacacc
gattcgcagacgccggattcggccggcaccatgaccgccatcaccaccggcgtgaagacc
cacatgggcgcgatcggtgtcagcgccggcagccgcaccgactgcgccgacagcctgtcc
aagggcctgctgacctggctgcagctggccgacagcgccggcctggccaccggtgtggtg
tccaccgcgcgcctgacccatgccacccctgctgccacctatgcgcactcgcccgagcgc
aactgggaaaacgacaccgacctgactgaagcggccaaggctgcaggctgcaaggacatc
gcacagcagctgctgtcgacctcgcgttatgggcgcggcccgctggtcgctctcggcggc
ggtcgcggtgaattcaccaccgtggaagagcgcgatccggaatacgacgacaaggtcggc
cagcgcctggatggccgcagcctggtgcaggaatggcagcaggcgcacccgcagggtgcc
tacgtgtggaacagcaagcagctggcggcggccgccaatgcgccggccatcctcggcctg
ttcgaaccggaccacatgcgctacgaatacgagcgcccgcaggatccgggcggtgagccg
agcctggccgaactgacggctgcagcgatcaggaatctggccaggcaccaggaaggctac
gtgctgatgatcgaaggcgcgcgcatcgaccacgccaaccacagcggcaacgcctaccgt
gcactgaccgagaccgtggcgctgtccgacgcggtgcgcgtggccaacgaactgacctcg
gccgacgacaccctgatcatcgtcaccgccgaccactcgcatacgctgaacttcgtcggc
tacccggcacgtggcaatccgatcctgggcaaggtgaaggacaagggcggcgaagatggt
gccggcaagctggactacgcgctggacggcaccggccagccgtacaccacgctgagctat
gccaacggcccgggccataccggcagcagcaaccagcagccggccggcccgaagcgttac
ccgcacaacccgagcagcttcgaaccggccaacggccgcccgaacctgcgcgaggtcgac
accgagcatccggactacatgcaggaagcactggtgccgatgaagtccgaatcgcacggt
ggtgaggatgtcggcatctgggcgcgtggcccgggcagcaaggcgatccgcggcacgctg
gaacagaacgcgatctatcacatgatcgtgcaggccaccccggccctgcgcgagcgcctg
tgccaggccggcacctgcgatgacaagggcgtgccggtgcagctgccggcaccgacggcc
ttcgagcgcaaggccgaggccaagtga

DBGET integrated database retrieval system