KEGG   Stenotrophomonas maltophilia D457: SMD_3119Help
Entry
SMD_3119          CDS       T02061                                 

Gene name
nagZ
Definition
beta N-acetyl-glucosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
smz  Stenotrophomonas maltophilia D457
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Module
beta-Lactam resistance, AmpC system
Brite
KEGG Orthology (KO) [BR:smz00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SMD_3119 (nagZ)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    SMD_3119 (nagZ)
Enzymes [BR:smz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SMD_3119 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3461904..3462911)
Genome map
AA seq 335 aa AA seqDB search
MLLIGVAGTELTAQERDWLQHDAVAGVVLFKRNFASRQQVTDLSAAIRAAAPRPQLICVD
QEGGRVQRFREGYSALPPLQDIGALYAADPQQALALAEQHAWLMASEVRASGLDLSFAPV
VDLGRGNRAIGNRAFSEDPQVVAAFTAAYVRGMHAVGMAATLKHFPGHGTVLEDTHVDTA
IDPRALDELRAQDLVPFQAGIAAGADAVMMAHVIYPQVAPEPAGYSPRWIQDILRGELGF
RGVVFSDDIGMAASHSAGGVPARVHAHLDAGCDVVLVCHPELVDEALHAVQGRSLNTAAL
LGLLGRGALGWDGLLADARHGDTQSRLLETLGRTV
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgatcggcgttgccggcaccgaactgaccgcccaggaacgtgactggctgcag
cacgacgccgtggccggggtggtgctgttcaagcgcaacttcgcctcgcgccagcaggtg
accgatctgagtgcggcgatccgtgccgccgccccgcgcccgcagctgatctgcgtggac
caggaaggcggccgtgtgcagcgtttccgcgagggctacagcgcgctgccgccgctgcag
gacatcggcgcgctgtacgccgccgacccgcagcaggcgctggccctggccgagcagcat
gcctggctgatggccagcgaagtacgtgccagcggcctcgacctgagtttcgcgccggtg
gtcgaccttggccgcggcaaccgcgccatcggcaaccgtgccttcagtgaagacccgcag
gtggtggccgcgttcaccgccgcctatgtgcgcggcatgcatgcggtcggcatggccgcc
acgctcaagcatttccccggccacggcaccgtgctggaagacacccacgtcgataccgcg
atcgacccgcgcgcgctggacgaactgcgcgcccaggacctggtgccgttccaggccggc
atcgccgccggtgccgatgcggtgatgatggcgcacgtgatctatccgcaggtggcgccg
gagccggccggctattccccgcgctggatccaggacatcctgcgtggcgagctcggcttc
cgtggcgtggtgttctccgatgacatcggcatggccgcctcgcacagtgccggtggcgtg
ccggcacgcgtgcacgcgcacctggatgccggctgcgacgtggtgctggtctgccacccg
gaactggtcgatgaagccctgcacgcggtgcagggacgctccctcaatactgctgcgctg
ctgggcctgcttggccgcggcgcgctcggctgggacggcctgctggccgacgcccgccat
ggcgacacccaatcccgtctgcttgaaacccttggaagaaccgtctga

DBGET integrated database retrieval system