KEGG   Stenotrophomonas maltophilia D457: SMD_3490Help
Entry
SMD_3490          CDS       T02061                                 

Gene name
pfk
Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
smz  Stenotrophomonas maltophilia D457
Pathway
smz00010  Glycolysis / Gluconeogenesis
smz00030  Pentose phosphate pathway
smz00051  Fructose and mannose metabolism
smz00052  Galactose metabolism
smz00680  Methane metabolism
smz01100  Metabolic pathways
smz01110  Biosynthesis of secondary metabolites
smz01120  Microbial metabolism in diverse environments
smz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:smz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMD_3490 (pfk)
   00030 Pentose phosphate pathway
    SMD_3490 (pfk)
   00051 Fructose and mannose metabolism
    SMD_3490 (pfk)
   00052 Galactose metabolism
    SMD_3490 (pfk)
  Energy metabolism
   00680 Methane metabolism
    SMD_3490 (pfk)
Enzymes [BR:smz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SMD_3490 (pfk)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     SMD_3490 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: CCH14004
Position
3898765..3900021
Genome map
AA seq 418 aa AA seqDB search
MRNGTLLYAQSGGVTAVINATAAAVIEQARAKGIKVLAARNGILGALREELIDTSKESAA
AIRALAHTPGGAFGSCRVKLKSLDADRARYDRLLEVLRAHDVRWFLYNGGNDSADTALKV
SQLAKASGYDLTCIGVPKTIDNDLAVTDTCPGFGSAAKYTAVSVREAALDVAAMAETSTR
VFIYEAMGRHAGWLAAAAGLAGNGDDEAPHIILLPERAYDEAAFLAKVKAVVERVGYCVV
VASEGIATADGRFVADAGGGKDSFGHSQLGGVAAHLAARVKDQLGLKVHWALPDYLQRSA
RHLASRTDWEQAQAVGKAAVQLALKGQNGVMPVIVRSSDAPYRWKIEAAPLSKIANHEKK
MPAGFIRRDGFGITAKARAYLSPLIKGEAPLPYGTDGLPKYVTLKNVAVKQKLPAFEG
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaacggtactctcctttatgcccagtccggcggtgtcaccgccgtcatcaacgcc
acggcggcggcggtgatcgagcaggcgcgggccaagggcatcaaggtcctggccgcccgc
aacggcatcctcggcgccctgcgcgaggagctgatcgacaccagcaaggagagtgccgcg
gccatccgcgcgctggcccataccccgggcggtgccttcggctcgtgccgggtcaagctg
aaatcgctggacgccgaccgcgcccgctacgaccgcctgctggaggtgctgcgcgcgcac
gacgtgcgctggttcctctacaacggcggcaacgactcggccgataccgcgctgaaggtc
tcgcagctggccaaggcctccggctacgacctgacctgcattggcgtgcccaagaccatc
gacaacgatctggcggtgaccgacacctgccccggcttcggctcggcggccaagtacacc
gccgtctcggtgcgcgaggcggcgctggacgttgcggcgatggccgagacctccacccgc
gtcttcatctacgaggcgatgggccgccacgccggctggctggccgcggccgccggcctg
gctggcaacggtgatgacgaagcaccgcacatcatcctgctgcccgagcgcgcctacgac
gaggccgcattcctggccaaggtgaaggccgtggtcgagcgcgtcggctactgcgtggtg
gtggcgtcggaaggtatcgcgaccgccgatggccgcttcgtcgccgacgcaggcggcggc
aaggactcgttcggtcactcgcagctgggcggcgtggccgcgcaccttgctgcacgggtc
aaggaccagctgggcctgaaggtgcactgggcgctgccggactacctgcagcgctcggcc
cgccacctggccagcaggaccgactgggagcaggcacaggcggtcggcaaggccgccgtg
cagctggcactgaagggccagaacggcgtgatgccggtgatcgtgcgcagcagcgatgcg
ccctatcgctggaagatcgaagcggccccgctgtcgaagatcgccaaccacgaaaagaag
atgccggccggcttcatccgccgcgatggcttcggcatcaccgccaaggcgcgcgcctac
ctgtcgccgctgatcaagggcgaagcgccgcttccctatggcaccgacggcctgccgaag
tacgtcactctgaagaacgtggcggtgaagcagaagctgccggccttcgagggctga

DBGET integrated database retrieval system