KEGG   Stenotrophomonas maltophilia D457: SMD_3616Help
Entry
SMD_3616          CDS       T02061                                 

Definition
N-acetylglucosamine kinase (EC:2.7.1.59)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
smz  Stenotrophomonas maltophilia D457
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:smz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SMD_3616
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMD_3616
   00052 Galactose metabolism
    SMD_3616
   00500 Starch and sucrose metabolism
    SMD_3616
   00520 Amino sugar and nucleotide sugar metabolism
    SMD_3616
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SMD_3616
   00524 Butirosin and neomycin biosynthesis
    SMD_3616
Enzymes [BR:smz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SMD_3616
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4047747..4048766
Genome map
AA seq 339 aa AA seqDB search
MTASHPAPSHVLSRVAPSFLAADVGGTHVRVARVQASGDTAHPVQVLEYRKYRNADHAGL
SAILSDFLGEGPRPTHCVVASAGYAREDGTVITANLPWPLSARQVEADVGLQRVYIVNDF
EAVAYAAAQVDASGVLHLCGPDTAARGPTLVVGPGTGLGAALWIPTAHGPVVLPTEAGQP
TLAASTELEMAIVRHMQRDRAHVSIEHAISGPGLMNLYRAVCALQRQAPTLASPDAVTAA
AMADTDAHARQALDVFCGLLGSTIGDMALFYGAHGGVYLAGGILPQIREYLHASTFVERY
LQKGPMGEALARIPVKVVEHGQLGVVGAASWYLQQQSAA
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgccagccaccccgccccgtcgcatgtcctgtcccgcgtcgcgccctcgttcctg
gccgcggacgtcggtggcacccatgtgcgcgtggcccgggtccaggccagcggtgacacc
gcccatccggtgcaggtgctggaataccgcaagtaccgcaacgccgaccatgccggcctc
agcgcgatcctgtccgacttcctcggcgaaggcccgcggcccactcattgtgtggtcgcc
agcgccggctacgcccgcgaggacggcacggtgatcaccgccaacctgccgtggccgctg
tcggcacgccaggtggaggccgatgtcggcctgcagcgggtctacatcgtcaatgacttc
gaagcggtggcctatgccgccgcgcaggtggacgccagtggcgtgctgcacctgtgcggg
ccggacaccgctgcgcgtggcccgaccctggtggtcggtcccggcaccggcctcggcgcc
gcgctgtggatccccactgcgcacggcccggtggtgctgccgacggaagccggccagccg
accctggccgccagcaccgaactggaaatggccatcgtccgccacatgcagcgcgaccgc
gcgcacgtgtcgatcgagcatgcgatctccggcccgggcctgatgaacctgtaccgcgcg
gtgtgcgcgctgcagaggcaggcaccgacgctggccagccccgatgcggtcaccgccgcc
gccatggccgataccgatgcacacgcgcgccaggcgctggatgtgttctgcggcctgctc
ggcagcaccatcggcgacatggccctgttctatggtgcccacggtggcgtctacctggcc
ggcggcatcctgccgcagatccgcgaatacctgcacgccagcaccttcgtcgaacgctac
ctgcagaaggggccgatgggcgaagcactggcacgcatcccggtgaaggtcgtcgaacac
ggccagctgggcgtggtcggcgctgccagctggtacctgcagcagcagtcggccgcctga

DBGET integrated database retrieval system