KEGG   Stenotrophomonas maltophilia D457: SMD_3618Help
Entry
SMD_3618          CDS       T02061                                 

Gene name
nahB
Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
smz  Stenotrophomonas maltophilia D457
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smz00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SMD_3618 (nahB)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SMD_3618 (nahB)
Enzymes [BR:smz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SMD_3618 (nahB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4051685..4054042
Genome map
AA seq 785 aa AA seqDB search
MVKPSRARMRSAVLLGSLLALLPALPALAADPMPAAEAPGPQLRAGSLMLIPAPSNVQPG
QGSGITVRADTVLQAEGEAAQRVASQFADLLARSGGPRLGLAKGKAAARTGGIRFQIVPT
FRDSGEGYTLESTAQGVVVQAGNETGLFYGATTLAQLATGGSNGVLPAVQIQDAPRFSWR
GFMLDSARHFQSLDEIKRVLDAMAAHKLNTFHWHLTDDQGWRMEIKRYPKLTGVGSCRLP
AGDGGIDPVTGKEHPYCGFYTQDQIREVIAYAAKLHIQVIPEIDVPGHATAAIAAYPELG
SINTPLKPISEWGVFPNLFNVEDSTVTFLENVLEEVIELFPAKYVHVGGDEAVKDQWEAS
RQVQQRMRALGIKDEMAMQSHIIKRLETFLEEHDRRLIGWDEILEGGLPPQATVMSWQGT
EGGLAAASAGHDVVMSPVGYLYLDYLQTASPNEPPGRPAQVNLGKLYNFEPVPAELAADK
RGHILGLQANMFTEHTRTYARLQHNLFPRLAAVAETGWSTPEHRDFRDFLARLPAQLQRY
RAWGLAYAQTPFEVGVDYTDNRAANTVTVSLANPLGYEVRYSTDGQPVTAQSPLYRQPLT
STLPTTVQAAAFYQGQMLAAKPTVADFSAQSLLSRRSDELLSCVGKKGLVLRLEDDGPRE
GNRAVFNVDIFQPCWRWPQAQLDGIGSVEVRAGRIPYYFQLAHDEPKRRFEKAKRAHGEM
LVRRGDCSGKVLAEVPLPATPDADGFVTLRATLPKGSQGTGDLCINFTGDTRPAMWVLDE
VTLGK
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atggtcaagccttcccgcgcccggatgcgcagcgcagtgctgctgggcagcctgctcgcc
ctgttgccggcactgccggcacttgccgccgaccccatgccggccgctgaggcacccggc
ccgcagctgcgtgccggcagcctgatgctgattcccgcccccagcaatgtgcagcctggc
cagggcagcggcatcaccgtgcgcgccgataccgtgctgcaggccgaaggcgaggccgca
cagcgcgtcgccagccagttcgccgacctgctggcgcgcagtggcggcccgcgcctgggg
ctggccaagggcaaggcggcggccaggaccggtggcatccgcttccagatcgtgcccacc
ttccgcgacagcggcgagggctacacgctggaaagcaccgcacagggcgtagtggtacag
gccggtaacgaaaccggcctgttctatggcgcaaccaccctcgcccagctcgccaccggc
ggcagcaacggcgtgctgccagcggtgcagatccaggacgcgccacgcttcagctggcgc
ggtttcatgctcgattcggcgcggcatttccagagcctggacgagatcaagcgcgtgctc
gacgcaatggccgcgcacaagctcaacaccttccattggcacctgaccgatgaccagggt
tggcgcatggagatcaagcgctatccgaagctgaccggagtgggcagctgccgcctgccg
gccggcgacggtggcatcgatccggtcactggcaaggagcatccgtattgcggcttctac
acgcaggaccagatccgcgaagtgattgcctatgccgcgaagctgcatatccaggtgatt
ccggaaatcgatgtgccggggcacgcgaccgcagcgattgccgcatacccggaactgggt
tcgatcaataccccgctgaagccgatcagcgaatggggcgtgttcccgaacctgttcaac
gtggaagacagtactgtcaccttcctcgagaacgtactggaggaagtgatcgaactgttc
ccggccaagtacgtgcacgtcggcggcgacgaggcggtcaaggaccagtgggaagcctcc
aggcaggtccagcagcgcatgcgtgcgctgggcatcaaggatgaaatggccatgcagagc
cacatcatcaagcgcctggagaccttcctggaggagcacgaccggcgcctgatcggctgg
gatgaaatccttgaaggcgggctgccgccgcaggccacggtgatgtcctggcagggcacc
gaaggtggcctggccgcggccagtgctggccatgacgtggtcatgtcgcccgtgggctac
ctctatctggattacctgcagacggcctcgccgaacgaaccgccgggccgcccggcccag
gtcaacctcggcaagctgtacaacttcgagcccgtgccggccgagctggccgctgacaag
cgcgggcacatcctcggcctgcaggccaacatgttcaccgaacatacgcgcacctatgcg
cgcctgcagcacaacctgttcccgcgcctggccgcggtggccgagaccggctggagcacg
ccggaacatcgcgacttccgcgatttcctcgcgcgcctgcccgcgcagctgcaacgctac
cgcgcctggggcctggcctacgcgcagaccccgttcgaagtgggcgtggactacaccgac
aaccgcgccgccaacacggtgaccgtgtcgctggccaacccgctgggctatgaagtgcgc
tacagcaccgatggccagccggtgacggcgcagtcgccgctgtaccggcagccgctgacc
agtacgctgccgaccacggtgcaggccgccgcgttctaccagggccagatgctggcggcg
aagccgacggtcgcggacttcagtgcgcaatcgctgctcagccgccgcagtgacgaactg
ctcagctgcgtaggcaagaaggggctggtgctgcgcctggaagacgatggcccgcgcgag
ggaaaccgcgcagtgttcaacgtggacatcttccagccatgctggcgctggccacaggca
cagctggacggcatcggcagcgtggaagtccgcgcggggcgtattccgtactacttccag
ctggcccacgacgagcccaagcgtcgcttcgagaaggccaagcgtgcgcatggcgagatg
ctggtgcgtcgcggcgactgcagcggcaaggtgctggccgaagtgccgctgccggccacg
ccggatgccgatggcttcgtgacgctgcgtgcgacgctgccgaagggctcccagggcacc
ggtgacctgtgcatcaacttcaccggcgacacgcgcccggcgatgtgggtgctggatgag
gtcacgctggggaagtga

DBGET integrated database retrieval system