KEGG   Stenotrophomonas maltophilia D457: SMD_3933Help
Entry
SMD_3933          CDS       T02061                                 

Definition
dihydrolipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex (EC:2.3.1.168)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
smz  Stenotrophomonas maltophilia D457
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:smz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SMD_3933
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMD_3933
   00020 Citrate cycle (TCA cycle)
    SMD_3933
   00620 Pyruvate metabolism
    SMD_3933
Enzymes [BR:smz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SMD_3933
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4401719..4403107
Genome map
AA seq 462 aa AA seqDB search
MSQTKNFNLPDLGEGLPDATIVEWFVKEGDVIKLDEPLVSMETAKAVVEVPSPFSGKVLK
LSGGAGDIIPTGSVLASFELDPNLPQRADGQDTGHSHGHAAPAAAPTPPPLPAAAAPAAA
EEAKPAAAERDDAGTVVGAMQSSNAVHAEQALAVGGVKAVPAVRAMARKLGVDLSRVAAT
GTDGAVTMADVKQAAANGSAKLGAAPAPVAAAAYAAPAPAQVSAPVQSEARTPLSAAGKP
MRTQPPGVVAKGQPEPLKGVRRNMARVMADAHSKVVPTTLNDDADIHAWLPGNDVTARLV
RSIVVAAQKVPAMNAWFDGEALTRTLHAQVDIGIAVDTDDGLFVPALRNADMLDARGIRE
GVNRLREQVESRSIAASELSGYTISLSNFGMFAGRYATPVVVPPCVAIVGAGRARHQMTP
VMGGVEAHKVIPLSVTFDHRAATGGEAARFLRAMMDDLALAS
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgagccagaccaagaacttcaacctgcccgacctgggcgaaggcctgccggacgcgacc
atcgtcgagtggttcgtcaaggaaggcgatgtgatcaagctggacgagccgctggtgtcg
atggagaccgccaaggccgtggtggaagtgccctcgccgttctccggcaaggtgctgaag
ctgtccggcggcgccggcgacatcatcccgaccggctcggtgctggccagcttcgaactg
gacccgaacctgccgcagcgagccgatggccaggacaccggccacagccatggccacgct
gcaccggcggccgcaccgaccccgccgccgctgccggctgcggccgctccggctgccgcc
gaggaggccaagcccgccgcggccgagcgcgatgacgccggtaccgtggtcggcgcgatg
cagagctccaatgccgtgcatgccgaacaggcgctggccgtcggtggcgtcaaggccgtg
ccggccgtgcgtgcgatggcgcgcaagctgggcgtggacctgagccgcgtggccgctacc
ggcaccgatggcgcggtgaccatggccgacgtcaagcaggctgccgccaacggcagcgcc
aagctcggcgctgctccggcaccggttgccgctgctgcctatgccgcgccggccccggcg
caggtgtctgccccggtgcagagcgaagcccgcaccccgctgtccgccgccggcaagccg
atgcgtacccagccgccgggcgtggtcgccaagggccagccggaaccgctgaagggcgtg
cgccgcaacatggcacgcgtgatggccgatgcgcacagcaaggtcgtgccgaccacgctg
aacgacgacgccgacatccacgcctggctgccgggcaacgacgtcaccgcgcgcctggtg
cgttcgatcgtggtcgccgcgcagaaggtgccggcgatgaacgcctggttcgacggtgaa
gcgctgacccgtaccctgcacgcgcaggtggacatcggcatcgccgtggacaccgacgac
ggcctgttcgtgccggccctgcgcaacgccgacatgctcgacgcacgcggcatccgcgaa
ggcgtcaaccgcctgcgcgagcaggtggaatcgcgttcgatcgcggcgtcggaactgagt
ggctacaccatctcgctgtccaacttcggcatgttcgccggccgctacgcgaccccggtc
gtggtgccgccgtgcgtggccatcgtcggtgccggccgagcccgccaccagatgaccccg
gtgatgggcggcgtggaagcgcacaaggtgatcccgctgtcggtcaccttcgaccaccgc
gcagccacgggtggtgaagctgcccgcttcctgcgcgcgatgatggacgacctggcactg
gccagctga

DBGET integrated database retrieval system