KEGG   Stenotrophomonas maltophilia D457: SMD_4192Help
Entry
SMD_4192          CDS       T02061                                 

Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
smz  Stenotrophomonas maltophilia D457
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:smz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMD_4192
Enzymes [BR:smz01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     SMD_4192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4712495..4713385)
Genome map
AA seq 296 aa AA seqDB search
MQSNPDISTGLYHGLEAWQIRTPSATAVISVFGGQLLSFIPEGQPDLLWLSPKRAGLPTP
IRGGVPVCWPWFGRQGQSDDVPAHGLVRTARWELLQARQDDDGELELQLAPLSIAECGLR
LQMQLRIGRQLRQQLTTENTGPSPVAFTQALHSYFRVGDARRVEVDGLDGLHYLDKYEDY
TQLRRQQGPWSLRDPRDPGRSDRIYTGAGGHYVLRDPVLQRRIEIRSEGSQTLVAWNPGA
EAAAKMADVGDGWHDYVCLEVANAGPEQIALAPGARHQLVQVLASEPLQAVAGCSE
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgcagtcgaacccggacatcagcaccggcctgtaccacgggctcgaggcctggcagata
cgcacgcccagcgccaccgcggtcatcagcgtgttcggcggacagctgctgtcgttcatc
ccggaggggcagccggacctgctgtggctgtcgccgaaacgggccgggctgcccacgccg
atccggggtggcgttccagtgtgctggccgtggttcggtcgccagggccagagtgatgac
gtgccggcacacggcctggtacgcaccgcgcgctgggagctgctgcaggcccgccaggac
gatgacggtgaactggagctgcagctggcgcccctgtcgattgccgagtgtggcctgcgc
ctgcagatgcagctgcgcatcggtcgccagctgcgccagcagttgaccaccgagaacacc
ggcccgtccccggtggctttcacacaggccctgcacagctacttccgggtaggcgatgcc
cgtcgtgtcgaggttgatggcctcgatggcctgcactatctggacaagtacgaggattac
acgcagctgcgccggcagcaggggccctggtcgctgcgtgacccgcgcgatccggggcgc
agcgaccgcatctataccggtgccggtggccactacgtgcttcgcgatcccgtcctgcag
cggcggatcgagatccgcagcgaaggcagccagaccctggtggcgtggaatccgggcgcg
gaggcggcggcgaagatggccgatgtcggcgacggttggcacgattacgtgtgcctggaa
gtagccaatgccgggccggagcagattgcccttgcacccggcgcgcgccaccagctggtg
caggtactggccagtgaaccgctgcaggccgtggcggggtgttcggagtaa

DBGET integrated database retrieval system