KEGG   Stenotrophomonas maltophilia D457: SMD_4202Help
Entry
SMD_4202          CDS       T02061                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
smz  Stenotrophomonas maltophilia D457
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:smz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SMD_4202 (folE)
Enzymes [BR:smz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     SMD_4202 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4725550..4726161)
Genome map
AA seq 203 aa AA seqDB search
MSKNNEKAAPQGDVTQDQAEDAVRTLLRWAGEDPSREGLLDTPRRVAEAYGDWFSGYRDD
PRAYMERTFEEVAGYDELIVLRDIEYESHCEHHMAPIIGRVHVGYLPAGKVVGISKLARV
VEAYARRFQVQEKMTAQIAQCIQDVLQPIGVGVVVEGAHECMTTRGIHKRGVSMVTSKML
GSFRDDARTRAEFLRFIEVGGKR
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaacaacgaaaaggccgccccgcagggcgacgtgacccaggaccaggccgag
gatgccgtgcgcaccctgctgcgctgggccggcgaggacccgtcccgcgaaggcctgctg
gataccccccgccgtgtcgccgaagcctatggcgactggttcagcggttaccgcgacgac
ccgcgcgcctacatggagcggaccttcgaggaagtggccggctacgacgaactgatcgtc
ctgcgtgacatcgagtacgaaagccactgcgagcaccacatggcgccgatcatcggccgc
gtccacgtcggctacctgccggccggcaaggtggtgggcatcagcaagctggcccgcgtt
gtcgaagcctacgcccgccgtttccaggtgcaggagaagatgaccgcgcagatcgcccag
tgcatccaggatgtgctgcagccgatcggcgtcggtgtggtcgtcgaaggtgcccacgaa
tgcatgaccacccgcggcatccacaagcgcggcgtcagcatggtcacctcgaagatgctg
ggcagcttccgcgacgacgcgcgtacccgcgccgagttcctgcgcttcatcgaagtgggc
ggcaagcgctga

DBGET integrated database retrieval system