KEGG   Stackebrandtia nassauensis: Snas_0304Help
Entry
Snas_0304         CDS       T01194                                 

Definition
glycoside hydrolase clan GH-D
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
sna  Stackebrandtia nassauensis
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:sna00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Snas_0304
  Lipid metabolism
   00561 Glycerolipid metabolism
    Snas_0304
   00600 Sphingolipid metabolism
    Snas_0304
Enzymes [BR:sna01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Snas_0304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
316472..317761
Genome map
AA seq 429 aa AA seqDB search
MTFDEAARLRVDPGAGRVYEHGWQSWSPTREYPVAGTSYRQRTEYVHTGHLRPEKPVPTD
GFQAEGLLVATDADGAAHRFATGSATDIPSIRARLDGDRLVVTADGTVEHTVHADVDTAL
TSFGDAFAARAGVSVRPAPTVWCSWYHYFTDVTEADIDENLDAIGEHELPVDVIQIDDGW
QKAVGDWLDLSDRFTSLSRIVKRINDSGRRAGVWVAPFLALATSDLVRDHPEWIIDGAAG
HNWGTETRGVDPRRARTYLTDVFTMLREAGFDYFKLDFLYAGAIDSVEAYREGLAEIRRV
VGPESYVLGCGAPILPSVGLVDAMRVGPDIAVTYEPGNGDPCHPSQRGAAANTIARAWQH
GRFWANDPDCLIARPEVERREEWADTVERYGGLVSVSDRIAALDEWGMDTTRRLLSNPPG
PGPLAHGRG
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaccttcgacgaagccgcccggctgcgcgtcgacccgggcgccgggcgggtgtacgag
cacggctggcagtcgtggagccccacccgcgagtacccggtcgccgggacgtcgtaccgg
cagcgcaccgagtacgtgcacaccgggcacctgcgacccgagaaaccggtgccgaccgac
ggtttccaggccgagggcctgctggtcgccaccgacgccgacggcgccgcgcaccggttc
gcgaccggctcggcgaccgacatcccgtcgatccgggcgcggctggacggcgaccggctc
gtcgtcaccgccgacggaaccgtcgaacacaccgtccacgccgacgtcgacaccgcgctg
acctccttcggcgacgcgttcgccgcgcgagcgggcgtgagcgtgcgtcccgccccgacc
gtgtggtgctcctggtaccactacttcaccgacgtgaccgaagccgacatcgacgagaac
ctggacgcgatcggcgaacacgagctgcccgtcgacgtcatccagatcgacgacggctgg
cagaaagcggtcggcgactggctcgacctgtcggaccgcttcacctcactgagccggatc
gtcaagcgcatcaacgactccggacgccgcgcgggcgtatgggtcgcaccgttcctggcg
ctggccaccagcgacctcgtccgcgaccatcccgagtggatcatcgacggcgccgccgga
cacaactggggcaccgagacccggggcgtggacccacgtcgcgcccgcacctacctcacc
gacgtgttcacgatgctgcgcgaggccgggttcgactacttcaagctggacttcctgtac
gcgggcgccatcgacagcgtcgaggcgtaccgggaggggctggccgagatccgccgggtc
gtcggcccggagtcctacgtcctcggctgcggcgcccccatcctgcccagcgtcgggctg
gtcgacgcgatgcgcgtcggccccgacatcgccgtgacctacgaacccggcaacggcgac
ccctgccacccgtcgcagcggggcgccgccgccaacacgatcgcccgcgcctggcagcac
ggccggttctgggccaacgaccccgactgcctcatcgcgcgccccgaggtggagcggcgc
gaggagtgggcggacaccgtggagcgctacggcggcctcgtctcggtgtcggaccgcatc
gccgccctcgacgagtggggaatggacacgacccgccgtctactgtcgaacccgcccggg
ccgggcccgctggctcacggccgcgggtag

DBGET integrated database retrieval system